KEGG   Acinetobacter equi: AOY20_05125Help
Entry
AOY20_05125       CDS       T04103                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
aei  Acinetobacter equi
Pathway
aei00020  Citrate cycle (TCA cycle)
aei00620  Pyruvate metabolism
aei00650  Butanoate metabolism
aei01100  Metabolic pathways
aei01110  Biosynthesis of secondary metabolites
aei01120  Microbial metabolism in diverse environments
aei01130  Biosynthesis of antibiotics
aei01200  Carbon metabolism
Module
aei_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aei_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOY20_05125
   00620 Pyruvate metabolism
    AOY20_05125
   00650 Butanoate metabolism
    AOY20_05125
Enzymes [BR:aei01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     AOY20_05125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans LUD_dom DUF4154
Motif
Other DBs
NCBI-ProteinID: ALH94966
UniProt: A0A0N9VV06
Position
complement(1105136..1106653)
Genome map
AA seq 505 aa AA seqDB search
MSLDRIRLASLHDKVISAEEASAFIEDGMTVGMSGFTRAGEAKAVPLALVKRAHTNPLKI
TLITGASLGNDLDKQLTEAGVLARRLPFQVDNTLRKAINKGEVMFIDQHLSETVEQMRNH
QLQKPDIAVIEAVAITEDGGIIPTTSVGNSASFAIFADKVIVEINTNLSPAFEGLHDIYI
PTYRPTRQPIPLTQVDERIGTPAINIDPSKIVGIVFNSELHDSPSTVTEPDAETQAIANH
LIAFFEKEVAEERLPKNLGPLQAGIGSIANAVLTGLKESNFEDLIMYSEVLQDCTFELID
AGKMKFASGSSITLSAKYGEKVFNNLEEYKDKLVLRPQEISNHPELVRRLGIIGINTALE
FDIYGNVNSTHVCGTKMMNGIGGSGDFARNAHLAIFVTKSIAKGGDISSIVPFASHVDHA
EHDVDILVTEQGLADLRGLAPRERAREIINHCAHPMYRDALNDYFDRACEKGGHTPHILR
EALSWHSNFEETGHMLAAHKDAKTA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtctttagatcgtattcgtttagcatccctgcatgacaaagtaattagcgcggaagaa
gcttctgcctttattgaagatggcatgacagtaggtatgagtggttttacacgtgctggc
gaagcaaaagctgtaccattggcattggttaaacgtgctcacacaaatcctttaaaaatt
acacttattacaggtgcttctctaggtaatgacctagataaacagcttaccgaagctggt
gtgttagcacgtcgtttaccattccaagttgacaatacattacgtaaagccatcaacaaa
ggcgaagttatgttcattgatcagcacttatctgaaacagttgaacaaatgcgcaatcat
caattacaaaagcctgatattgccgttattgaagctgttgcaattactgaagatggtggc
attatcccaacaacttctgtaggtaactctgcaagctttgcaatttttgctgataaagta
attgtagaaatcaatacaaatttaagccctgcgtttgaaggcttacacgatatttacatt
ccaacttatcgtccaactcgtcaaccaattccattaactcaagttgatgagcgcattggt
actccagcaatcaatatcgacccttctaaaattgtcggcattgtgttcaacagcgaactt
catgattctccatcaacagtgactgagccagatgctgaaactcaagcaattgcgaatcat
ttgattgcattctttgaaaaagaagttgctgaagagcgcttacctaaaaacttaggtcca
ttacaagcaggtattggttctattgcaaatgcagtattaacaggtcttaaagaatctaac
ttcgaagacttaatcatgtactcagaagtacttcaagactgtactttcgaattgattgat
gcaggaaaaatgaaatttgcatctggttcatcaattacgctttctgcaaaatatggcgaa
aaagtatttaacaatcttgaagaatacaaagataaacttgtattacgtccacaagaaatt
tccaaccaccctgaacttgttcgtcgtttaggtattattggtattaacactgctcttgag
ttcgatatttacggcaacgtaaactctactcacgtatgtggtactaaaatgatgaacggt
atcggtggttcaggtgacttcgcacgtaacgctcacctagcaatcttcgtgactaagtca
attgctaaaggtggagatatttcttcaatcgttcctttcgcatctcacgttgaccatgca
gaacatgacgtagatatcttggtaacagaacaaggtcttgctgatttacgtggtttagct
cctcgtgagcgtgctcgtgaaatcattaatcactgtgcacacccaatgtaccgtgatgca
ctaaatgactacttcgatcgtgcatgtgaaaaaggtggtcatactcctcacattcttcgt
gaagcgctttcttggcattctaatttcgaagaaactggtcacatgcttgcagctcacaaa
gatgctaaaacagcataa

DBGET integrated database retrieval system