KEGG   Acinetobacter equi: AOY20_10460Help
Entry
AOY20_10460       CDS       T04103                                 

Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
aei  Acinetobacter equi
Pathway
aei00540  Lipopolysaccharide biosynthesis
aei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aei00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    AOY20_10460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aei01003]
    AOY20_10460
   01005 Lipopolysaccharide biosynthesis proteins [BR:aei01005]
    AOY20_10460
Enzymes [BR:aei01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     AOY20_10460
Glycosyltransferases [BR:aei01003]
 Polysaccharide
  Bacterial polysaccharide
   AOY20_10460
Lipopolysaccharide biosynthesis proteins [BR:aei01005]
 Lipid A
  AOY20_10460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB Glyco_trans_1_4 Epimerase_2
Motif
Other DBs
NCBI-ProteinID: ALH96719
UniProt: A0A0N9W4L7
Position
2196898..2198070
Genome map
AA seq 390 aa AA seqDB search
MQNRKLRIGIVVGEVSGDTLGAKLIRSFREQGIDAEFEGIGGPQMIEEGFNSYYPMDILS
VMGIVEVLKDIKSLFAVRDGLVDAWSKKPVDVFIGIDAPDFNLRLSKAIKQKQLPIKTVQ
YVSPSVWAWRQGRVHGIKASIDLVLCLFPFEKSFFKQWNVPAAFVGHPLASQLPLDNSLT
NAKLELNLDPKQKYIALLPGSRRGEIEKLGPLVLDAAKLVAEKFPNYQFLIPAINDARKQ
QIEALIAEYPDALKSKIHLMDNTSTESKIGRQVMNAADIIALASGTATLEAMLLHRPMVT
FYKLNWLTYRIVKLLVKIQYYSLPNIIAGKKVITELIQKDATPEKLAYEIELLMNGETSQ
IQVMQHMTMHKKLLSGNSEDPVQAILQLLK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaatcggaagttgagaataggaatcgttgttggagaggtttcaggtgatacactt
ggagcgaaattgattcgtagttttcgtgagcaaggaattgatgccgaatttgagggaata
ggtggtcctcagatgatagaagaaggatttaatagttactatccgatggatattttatct
gtcatggggattgttgaagttttaaaagatatcaaaagtttatttgctgtacgagatgga
ttggttgatgcatggagtaaaaaacctgtagatgtttttattggtattgatgcgccagat
tttaatttacgtttatcaaaagcaataaaacaaaaacaattaccaattaaaactgtacaa
tatgtaagtccttctgtatgggcttggcgtcaaggacgagtacatgggattaaagcatca
attgatcttgtactttgcttattcccatttgaaaagtcattttttaaacaatggaatgta
ccagctgcttttgtagggcatccattagcaagtcaattaccattagataattcactcact
aatgcaaaactagaattaaacctagatccaaaacaaaaatatattgcgttattacctggt
agtcgccgtggtgaaattgaaaaacttggtcctttggtattggatgctgcaaaattggtt
gcggaaaaatttccaaattatcagtttttaattcctgccattaatgatgcgaggaaacaa
caaatcgaagcattaattgcagagtacccagatgctttaaaaagtaagattcatttgatg
gataatacatcaacagagtcaaaaattggccgacaagtgatgaatgctgcagatattatt
gctttagcttcaggtacggcaactttagaggcaatgctattgcatagaccaatggtgact
ttctataaacttaattggctaacttatagaattgtaaagttattagtaaaaattcaatac
tattccttaccaaatattattgcgggtaaaaaggttattactgaactcattcaaaaggat
gcaactcctgaaaaattagcctatgaaattgaattgttgatgaatggtgaaaccagccaa
atacaagtcatgcaacatatgacgatgcataaaaaactattgtcgggtaatagcgaagat
cctgttcaagccattcttcagttattgaagtaa

DBGET integrated database retrieval system