KEGG   Acinetobacter equi: AOY20_10465Help
Entry
AOY20_10465       CDS       T04103                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aei  Acinetobacter equi
Pathway
aei00071  Fatty acid degradation
aei00280  Valine, leucine and isoleucine degradation
aei00310  Lysine degradation
aei00362  Benzoate degradation
aei00380  Tryptophan metabolism
aei00620  Pyruvate metabolism
aei00630  Glyoxylate and dicarboxylate metabolism
aei00640  Propanoate metabolism
aei00650  Butanoate metabolism
aei00900  Terpenoid backbone biosynthesis
aei01100  Metabolic pathways
aei01110  Biosynthesis of secondary metabolites
aei01120  Microbial metabolism in diverse environments
aei01130  Biosynthesis of antibiotics
aei01200  Carbon metabolism
aei01212  Fatty acid metabolism
aei02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOY20_10465
   00630 Glyoxylate and dicarboxylate metabolism
    AOY20_10465
   00640 Propanoate metabolism
    AOY20_10465
   00650 Butanoate metabolism
    AOY20_10465
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOY20_10465
   00072 Synthesis and degradation of ketone bodies
    AOY20_10465
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOY20_10465
   00310 Lysine degradation
    AOY20_10465
   00380 Tryptophan metabolism
    AOY20_10465
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AOY20_10465
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOY20_10465
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AOY20_10465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aei04147]
    AOY20_10465
Enzymes [BR:aei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AOY20_10465
Exosome [BR:aei04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOY20_10465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALH95920
UniProt: A0A0N9W2I3
Position
complement(2198124..2199620)
Genome map
AA seq 498 aa AA seqDB search
MSTNNQENSTVDKTESPSSSNMTKAKPRITKNANTASHTKTQTKAASTTVRKRTSSSKIP
STSKTSDQQGHNMSQNTIRRVAIIGGNRIPFARSNGAYFSASNSDMLTAALNGLIERYNL
QGQCLGEVVAGAVLKHSRDFNMTRECVLNTELAPETPAYDLQQACGTGLQAAFLVANKIA
LGQIDVGIAGGVDTTSDAPIALGDSLRKALLKLNVAKSAKDRLKALSKINFKKLMEAPRN
GEPRTGLSMGDHQAITALEWGISRESQDELAAASHQKMAAAYEEGFFNDLITPFLGLERD
NNLRPDSTVEKLAKLKPAFGKGDARTMTAGNSTPLTDGASCVLLASEEWAKANGHEILAY
LSFSETAAVDFVGKKEGLLMAPAYAVPRMLERANLKLQDFDYYEIHEAFASQVLSTLKAW
EDPKFCKERLGLDAPLGSIDRDKLNVKGSSLAAGHPFAATGGRILATAAKLVNKKGSGRV
LISICAAGGQGVTAIVEK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaaataaccaagaaaactcaactgtagataaaactgagtctccatcttcgtca
aacatgactaaagcaaagcctcgtataactaaaaatgcaaatactgcatctcatacaaag
acgcaaactaaagctgcatcgacaaccgttcgaaaaagaacatcatcaagcaaaatacct
tcaacttctaaaacttccgatcaacagggtcataacatgagtcaaaatacaatccgtcgc
gttgcgattattggtggtaatcgcattccatttgcgcgttctaatggtgcatatttttca
gcgtcgaattcagacatgttaactgctgcattaaatggtttaattgagcgttataattta
caaggtcaatgtcttggggaagttgtcgctggtgctgttttaaagcacagtcgtgatttc
aatatgactcgtgaatgcgtactcaataccgaactggctccagaaactcctgcttatgat
cttcaacaagcatgtggtacaggtttacaggcagcttttctagttgcgaataaaattgct
ttaggtcaaattgatgtcggaattgcaggtggtgtagatacaacctcagatgcacccatt
gcactgggtgatagtttacgtaaagcactacttaaacttaatgttgcaaaatctgctaaa
gatcgtttaaaagcattatctaaaattaatttcaaaaaactcatggaagcaccaagaaat
ggtgagccacgtacaggtctttctatgggtgatcatcaagcaattacagcacttgaatgg
ggaatttctcgtgaatctcaagatgagctcgcagctgcttcacatcaaaaaatggcagct
gcttatgaagaaggtttctttaatgaccttatcacccctttcttaggcttagaacgtgat
aataacttacgtccagattctaccgtagaaaaacttgcaaaacttaagcctgcttttggt
aaaggtgatgcacgtaccatgactgcaggtaactcaacaccattaaccgatggtgcatct
tgtgttttattagcatctgaggaatgggctaaagcaaatggtcatgaaattttggcatat
ttaagctttagtgaaacggctgctgttgactttgtgggtaaaaaagaaggtttattaatg
gcgccagcttatgccgttccccgtatgcttgagcgtgcaaatcttaaactacaagatttt
gattattacgaaattcatgaggcatttgcatctcaagtgctttcaacactaaaagcgtgg
gaagatccaaaattctgtaaagaacgtttaggattagatgcaccactgggatcaattgat
cgtgataagttaaatgttaaaggttcatccttagctgctggacatccatttgcagcaact
ggtggtcgtattcttgcaacagcagcaaaactcgtaaataaaaaaggttctggtcgtgtc
cttatttcaatttgtgctgcaggtggacaaggtgtgactgcaattgttgaaaaatga

DBGET integrated database retrieval system