KEGG   Acinetobacter equi: AOY20_10745Help
Entry
AOY20_10745       CDS       T04103                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
aei  Acinetobacter equi
Pathway
aei00020  Citrate cycle (TCA cycle)
aei00620  Pyruvate metabolism
aei01100  Metabolic pathways
aei01110  Biosynthesis of secondary metabolites
aei01120  Microbial metabolism in diverse environments
aei01130  Biosynthesis of antibiotics
aei01200  Carbon metabolism
Module
aei_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aei_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOY20_10745
   00620 Pyruvate metabolism
    AOY20_10745
Enzymes [BR:aei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     AOY20_10745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-ProteinID: ALH95968
UniProt: A0A0N9VFA3
Position
complement(2253388..2255028)
Genome map
AA seq 546 aa AA seqDB search
MKKVFKWVLISLCISILLGYIFLFRPIASSINITQQKNTPTIDVVLIGGGIMSATLGTYL
YELEPNWKVQMFERLDQVAEESSKGLNNAGTGHSGFMEMNYTPEKNNQINIQKAVTTAEQ
FEVSKQFWAYQVKHHILHNPKSFIHPVPHVAFVWGKQNVDFLKKRYASMTQNPLFYGMKY
TENPIEIEKWAPLIMHGRNLKEKVAATHMDVGSDINYGEITKQLIQHLTTNPNFHLNTST
EVTGISQNNDKTWTISYLNLKNNQKGYIRTKYVFIGAGGATIKLLQYTGLKEAKQYAGFP
IGGTFLITDNPTITAQHTAKVYGRAELGAPPMSVPHIDTRYIDGKKYVLFGPFATYSNKF
LKHGSQSDLLMATHQNNIIPMLSVGFKNLDLVQYLIDQVMMSKQEQLKELRKYYPEAKSK
DWNLSQGGQRVQIIKKDSDQPAVLKFGTEIFASPDGTLTALLGASPGASTSSYIMLTLLE
QVFPKQVSSTWNHKIKKIVPSYQQELSKDPILLDHIRTYTSSTLGLDYTSRTTHNKDHQP
ILNTIH
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtctttaaatgggtactaatctctctatgtataagcattcttttgggatac
atttttctatttcgcccaattgcttcctcaattaatatcacacaacaaaagaatactccc
acaattgatgttgtactcattggtggaggtattatgagcgcaacattaggtacttacctc
tatgagcttgaaccaaattggaaagttcaaatgtttgaacgtctagatcaagtggctgag
gaaagctccaaaggactcaataatgctggaactggacattctggctttatggaaatgaat
tacacccccgaaaaaaataatcaaattaatattcagaaagccgtaactacagccgaacaa
tttgaagtgtcaaaacagttctgggcttaccaagtaaaacaccatattcttcacaatccc
aaatcttttattcatcctgttccccatgttgcttttgtttggggtaagcaaaatgttgat
tttctaaaaaaacgctatgcatccatgactcaaaaccctttattttatggaatgaaatat
acagaaaatccaatagaaattgaaaaatgggctccacttattatgcatggtcgcaattta
aaagaaaaagttgctgcaacgcatatggatgttggttccgacattaattatggagaaatc
accaaacaattgattcagcatcttactactaatccaaacttccacctaaacacctccaca
gaagtgacaggtattagccaaaacaatgataaaacatggacaatttcttatctcaattta
aaaaataatcaaaagggatatattcgaacaaaatatgtcttcattggtgcaggtggagca
accatcaaactactccaatacactggactaaaagaagcaaaacaatatgctggatttcct
attggtggaacatttctgatcacagataacccaaccattacagcacaacacacagctaaa
gtttatggtcgagcagagctaggggctccccctatgtccgttcctcatattgatacgcgc
tatattgatggcaaaaaatatgtactttttggtccatttgcaacctattcaaataagttt
cttaaacatggctcacaatctgacttacttatggcaactcatcaaaacaatattattcca
atgttaagtgttggctttaaaaatttagatcttgttcaatatttaatagatcaagtgatg
atgtctaaacaagaacaattaaaagaactccgaaaatattatccagaagcaaaatcaaaa
gactggaacttaagccaaggtggtcaacgcgttcaaattataaaaaaagattccgaccaa
cctgctgtacttaaatttggtactgaaatttttgcctcacctgatggcacacttactgca
ttattaggtgcatcccctggtgcatcaacatcatcctatattatgttaacgctgttagag
caagttttcccaaaacaagtttcttctacttggaatcataaaattaaaaaaatcgtacca
tcatatcagcaagaactcagtaaagaccctattctactcgaccatattcggacatacaca
agctcaacacttggtttagattacacttcacgtacaacgcataataaagatcaccaaccg
atcttaaatacaattcattaa

DBGET integrated database retrieval system