KEGG   Aeromonas sp. CU5: CK911_00065Help
Entry
CK911_00065       CDS       T05327                                 

Definition
(GenBank) divalent-cation tolerance protein CutA
  KO
K03926  periplasmic divalent cation tolerance protein
Organism
aem  Aeromonas sp. CU5
Brite
KEGG Orthology (KO) [BR:aem00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CK911_00065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CutA1
Motif
Other DBs
NCBI-ProteinID: ATL91371
UniProt: A0A291TEG3
Position
complement(14378..14695)
Genome map
AA seq 105 aa AA seqDB search
MTDAIVVLCTCPDQTSADLLCEQLLNQRLAACINQLPGITSVYRWQGKVERATEIQLIIK
SRQPLFAELQACIQTHHPYEVPELLALPVSGGLPAYLDWLNGETS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgccattgtggtgctctgcacctgcccagatcaaaccagtgccgaccttctc
tgcgaacagctgctgaaccagcggctggccgcctgcatcaatcaactgccgggcatcacc
tccgtctatcgttggcaaggcaaggtggagcgcgccaccgagatccagctcatcatcaaa
tcccgccagccactctttgccgagttgcaggcatgcattcaaacccatcacccctatgag
gtgccagagctgctggccctgccggtgagtggcggactacctgcctatctcgactggctc
aatggggagacctcatga

DBGET integrated database retrieval system