KEGG   Aeromonas sp. CU5: CK911_06260
Entry
CK911_06260       CDS       T05327                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
aem  Aeromonas sp. CU5
Pathway
aem00230  Purine metabolism
aem01100  Metabolic pathways
aem01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aem00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CK911_06260
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ATL92456
UniProt: A0A291TH36
Position
1409852..1410337
AA seq 161 aa
MMQPQSCPAVEIQCEINGKPYSYAVSPTMSLLYFLRGQGLISVKEGCSVGECGACTVRVD
GTAIDSCLYLAVWADGKSIRTVEGERKGNELSDVQQAFIDEGAVQCGFCTPGLVMASAAL
LDKTERRPLTDTEIRRGLSGNLCRCTGYQNVVRAVKKCCKG
NT seq 486 nt   +upstreamnt  +downstreamnt
atgatgcaaccgcaaagctgtcccgccgtggagatccagtgcgagatcaacggcaagcct
tactcctatgcggtgtcgcccaccatgtcgctgctctacttcctgcgtgggcaggggctg
atcagcgtgaaagaggggtgcagcgttggcgagtgcggcgcctgtaccgtgcgggtggat
ggcaccgccatcgacagctgtctttatctcgcggtatgggccgatggcaaatccattcgc
accgtggagggagagcgcaaaggcaatgagctttccgatgtgcaacaggcctttatcgac
gagggggcggtgcagtgcggtttttgcaccccgggtctggtgatggcgagcgcggcactg
ctcgacaagaccgagcgccgtccgctgaccgatacggagatccgccgcggcctctcgggc
aacctctgtcgttgtaccggctaccagaacgtggtgcgggcggtgaagaagtgctgcaag
gggtaa

DBGET integrated database retrieval system