KEGG   Arsenophonus endosymbiont of Aleurodicus dispersus: ARADI_0055Help
Entry
ARADI_0055        CDS       T05672                                 

Gene name
apaG
Definition
(GenBank) Protein ApaG
  KO
K06195  ApaG protein
Organism
aen  Arsenophonus endosymbiont of Aleurodicus dispersus
Brite
KEGG Orthology (KO) [BR:aen00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ARADI_0055 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: VAY02172
UniProt: A0A3B1E3N2
Position
I:complement(57015..57392)
Genome map
AA seq 125 aa AA seqDB search
MLNEPNICIQVQSFYIENQSLPEEDRFIFAYTVSIRNLGRKPVKLIRRYWLITNSDGKRT
EVQGQGVVGEQPIIQPSAEFRYTSGAIIETPMGTMEGHYVMLDHYGENFYVDIPVFRFAI
PKLIN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgctaaatgaacctaacatctgtatacaagttcaaagtttttatattgaaaatcaatcc
ttaccagaagaagatagatttatttttgcctatacagtttctattcgcaatcttgggcgt
aagccggtaaagttaataaggcgctattggttaattactaatagtgatggtaaacgtact
gaagtacaaggccagggtgtggtaggagagcaacctatcattcaaccaagcgctgaattt
cgttatactagtggtgctattatagaaacacccatgggaaccatggaaggtcattatgtt
atgttagaccattatggggaaaatttttatgttgatatcccagtatttcgttttgctatc
ccaaaactaatcaattaa

DBGET integrated database retrieval system