KEGG   Aeromonas salmonicida O23A: O23A_p1299Help
Entry
O23A_p1299        CDS       T04990                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aeo  Aeromonas salmonicida O23A
Pathway
aeo00071  Fatty acid degradation
aeo00072  Synthesis and degradation of ketone bodies
aeo00280  Valine, leucine and isoleucine degradation
aeo00310  Lysine degradation
aeo00362  Benzoate degradation
aeo00380  Tryptophan metabolism
aeo00620  Pyruvate metabolism
aeo00630  Glyoxylate and dicarboxylate metabolism
aeo00640  Propanoate metabolism
aeo00650  Butanoate metabolism
aeo00900  Terpenoid backbone biosynthesis
aeo01100  Metabolic pathways
aeo01110  Biosynthesis of secondary metabolites
aeo01120  Microbial metabolism in diverse environments
aeo01130  Biosynthesis of antibiotics
aeo01200  Carbon metabolism
aeo01212  Fatty acid metabolism
aeo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    O23A_p1299
   00630 Glyoxylate and dicarboxylate metabolism
    O23A_p1299
   00640 Propanoate metabolism
    O23A_p1299
   00650 Butanoate metabolism
    O23A_p1299
  09103 Lipid metabolism
   00071 Fatty acid degradation
    O23A_p1299
   00072 Synthesis and degradation of ketone bodies
    O23A_p1299
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    O23A_p1299
   00310 Lysine degradation
    O23A_p1299
   00380 Tryptophan metabolism
    O23A_p1299
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    O23A_p1299
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    O23A_p1299
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O23A_p1299
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aeo04147]
    O23A_p1299
Enzymes [BR:aeo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     O23A_p1299
Exosome [BR:aeo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   O23A_p1299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARW82042
UniProt: A0A1Z1NMU6
Position
1355214..1356377
Genome map
AA seq 387 aa AA seqDB search
MDIVIVAAKRTPMGAFQGALANLTAPELGACAIAAAIAQAGLKGEQIDEAYMGNVLSAGV
GQAPARQAVLKAGLPESVPCTTVNKVCGSGMKAVMLAADSLRLGDTDIVIAGGMESMSRA
PYLLDKARSGFRMGHQSVLDHMFLDGLQDAYEGQLMGHYAQLSADRAGLARSDMDAFAIA
SLTRALAAQQSGAFKAELAQVTVGDTLLLAEDEQPAKARPDKIPHLKPAFSKQGTITAAN
ASSISDGAAALILMRAETAAQLGLPVLAHLVGYQSHAAAPAEFTNAPIGAINALLSKIDW
RAEEVDLFEINEAFAMVSMLAMAGCNLPHDKVNVNGGACALGHPLGASGARILVTLIHAL
HARSLKRGVASLCIGGGEATAVAIELS
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatattgtgattgttgcggccaagcgtacccccatgggggccttccagggagccttg
gccaacctgaccgcccccgagcttggcgcttgcgccattgctgccgccatagcacaagcc
gggctcaagggggagcagatcgatgaagcctacatgggcaatgtgctcagtgccggggtg
gggcaggcacccgcccgtcaggctgtgttgaaggcaggtttgccggagagtgtgccatgc
accactgtcaacaaggtgtgtggttccggcatgaaggcggtgatgctggcggcagacagc
ttgcgtctgggtgacaccgacatagtgatcgccggtggcatggagagcatgagccgggcg
ccttacctgctcgacaaggcgcgcagcggttttcgcatggggcatcagagcgtgctggat
catatgttcctcgatggcttgcaggatgcttacgaaggccagttgatggggcattatgcc
cagttgagtgcggatcgcgccggtctggcccgctccgacatggacgcttttgccatcgct
tccctgacgcgtgcgctggctgcccagcagagcggtgctttcaaggccgagctggcccag
gttactgtcggtgacaccctgctgctcgccgaggatgagcagcctgccaaggccaggccc
gacaagatccctcatctgaaaccggcattcagcaagcagggcaccataacggctgccaat
gccagctccatctcggacggagcggcggcgctcatcctgatgcgagccgagacggcggcg
cagctgggcctgcctgtgctggcccatctggtgggttatcaaagtcatgccgctgcgcct
gccgagtttaccaatgcgcccatcggcgccatcaatgccttgctatccaagatcgactgg
cgggcggaagaggtcgatctattcgagatcaatgaggcgtttgccatggtcagcatgctg
gccatggcgggttgcaacctgcctcatgacaaggtgaacgtgaacggcggggcctgcgca
ctggggcatccactgggggcgagtggtgcccgtattctggttacgctcattcatgcactg
catgcgcgcagtctgaaacggggtgtggcaagcctgtgtatcggtggaggggaggcgact
gccgtcgccatcgagttgagctaa

DBGET integrated database retrieval system