KEGG   Aeromonas salmonicida O23A: O23A_p1451Help
Entry
O23A_p1451        CDS       T04990                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
aeo  Aeromonas salmonicida O23A
Pathway
aeo00450  Selenocompound metabolism
aeo00970  Aminoacyl-tRNA biosynthesis
aeo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aeo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    O23A_p1451
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    O23A_p1451
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aeo01007]
    O23A_p1451
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aeo03016]
    O23A_p1451
Enzymes [BR:aeo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     O23A_p1451
Amino acid related enzymes [BR:aeo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   O23A_p1451
Transfer RNA biogenesis [BR:aeo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    O23A_p1451
 Prokaryotic type
   Other AARSs
    O23A_p1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ARW82194
UniProt: A0A1Z1NN31
Position
1517675..1519687
Genome map
AA seq 670 aa AA seqDB search
MLVTCALPYANGSIHLGHMLEHIQADIWVRYQRMRGHQVHFICADDAHGTPIMLKAQQMG
ITPEEMIAAVSKEHQTDFAGFNISFDNYHSTHSDENRELAELIYGCLKDGGFIKGRTITQ
LFDPEKSMFLPDRFVKGTCPKCKSPEQYGDNCDSCGATYSPTELIDPKSAVSGATPVMKD
SEHFFFDLPQFETWLAGWVRGSGAIQEEMANKMQEWFESGLQQWDITRDAPYFGFEIPGA
PGKYFYVWLDAPIGYMASFKNLCNKRGDIDFDSYWKADSEAELYHFIGKDIAYFHCLFWP
SMLEGAGFRKPTKVNVHGYVTVNGAKMSKSKGTFIKASTYLNHLDPECLRYYYAAKLNSR
IDDLDLNLDDFVARVNADVVNKLVNLASRNAGFIAKRFDGKLAATCAEPELYAEFANASA
SISEAYEAREFSRAIREIMALADKANRYVDEKAPWVLAKQEGADAELQAVCSVGINLFRV
LMAYLKPVMPLLAERAEAFLGETLTWDGVALPLTNHQLTPFKALFSRIEPAKIEAMIEAS
KEDLAKEQAPKITGPLADDPISPTISYEDFAKLDLRVALIKKAEAVPEADKLLKLQLDLG
GETRQVFAGIKSAYNPEDLEGKLTVMVANLAPRKMRFGMSEGMVLAAGPGGKDLWILEPQ
EGAQPGMRVK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgctggtaacctgcgccctcccctacgccaatggctccatccatcttggccacatgctg
gaacacatccaggccgatatctgggttcgttatcagcgaatgcgtggccatcaggtgcac
ttcatctgtgccgatgatgcccatggcacccccatcatgctcaaggcgcaacagatgggg
atcaccccggaagagatgatcgcggctgtctccaaagagcaccagaccgacttcgccggt
ttcaatatcagcttcgacaactatcactccacccacagtgatgagaaccgcgaactggca
gagctgatctacggctgtctgaaagacggtggctttatcaagggccgcaccatcactcag
ctgttcgatccggaaaaatccatgttcctgccggaccgcttcgtcaagggcacctgcccc
aagtgcaagtctccggagcaatacggcgacaactgcgacagctgcggtgccacctacagt
ccgacagagctcatcgatccgaaatccgccgtctccggtgcgaccccggtgatgaaggac
tccgagcacttcttcttcgacctgccccagttcgaaacctggcttgccggctgggtacgc
ggctccggcgccattcaggaagagatggccaacaagatgcaggagtggttcgaaagcggc
ctgcagcagtgggacatcacccgcgacgccccctatttcggtttcgagatcccgggtgcc
cctggcaagtacttctacgtctggctggatgcccccatcggctatatggcgtcgttcaag
aacctgtgcaacaagcgcggcgacatcgattttgacagctactggaaagcggactccgag
gccgagctctatcacttcatcggcaaggacatcgcctacttccactgcctgttctggcca
tccatgctggaaggggcgggtttccgcaagccgaccaaggtcaatgtgcacggctatgtg
accgtcaacggtgccaagatgtccaagtccaagggcaccttcatcaaggcctccacctac
ctgaaccacctggatcctgagtgcctgcgttactactacgccgccaagctcaacagccgc
atcgacgatctggacttgaacctggatgacttcgtggcccgcgtcaacgccgacgtggtc
aacaagctggtcaacctcgcctcccgcaacgccggctttatcgccaagcgtttcgacggc
aagctggccgctacctgtgccgagcccgagctctatgccgagttcgccaacgccagcgcc
tccatcagcgaggcctatgaagcgcgcgaattcagccgcgccatccgcgagatcatggcg
ctggccgacaaggccaaccgctatgtggacgagaaggcgccctgggtgctggccaagcag
gaaggcgcagacgccgagctgcaggcggtctgctccgtgggcatcaacctgttccgcgtg
ctgatggcctacctcaagccggtcatgccactgttggccgagcgtgccgaagccttcctg
ggtgaaaccctcacctgggatggcgtcgccctgccgctaactaaccatcagctgaccccg
ttcaaggcgctgttctcccgcatcgagcccgccaagattgaagccatgatcgaggcctcc
aaggaggaccttgccaaggagcaagctcccaagatcacaggcccgctggcagatgatccc
ataagcccaaccatctcctatgaggatttcgccaagcttgatctgcgcgtggcgctgatc
aaaaaggcggaagcggtaccggaagcagacaagctgctcaagctgcaactggatctgggc
ggtgaaacccgtcaggtcttcgccggcatcaagtccgcctacaacccggaagatctggaa
ggcaagctgaccgtgatggtggccaacttggcgccgcgcaaaatgcgctttggcatgtcc
gaaggcatggtgctggccgcaggcccgggcggcaaggacctctggatcctggagccgcaa
gaaggcgcccagccaggcatgcgcgtcaagtaa

DBGET integrated database retrieval system