KEGG   Aeromonas salmonicida O23A: O23A_p2046Help
Entry
O23A_p2046        CDS       T04990                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
aeo  Aeromonas salmonicida O23A
Pathway
aeo00520  Amino sugar and nucleotide sugar metabolism
aeo01100  Metabolic pathways
aeo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    O23A_p2046
Enzymes [BR:aeo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     O23A_p2046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ARW82789
UniProt: A0A1Z1NQ76
Position
2185811..2186956
Genome map
AA seq 381 aa AA seqDB search
MYALTNCTLYTGSCVLTGYGVVIEGDKIVAIQRQAELPAGIERHDLHGANLSAGFIDVQL
NGCGGVMFNTDISTETLAIMQAANLKSGTTSFLPTLITSPDSDMKRAVAVTRDYMAAHPN
EVLGVHLEGPYTNLKRKGIHPAAQIRQPADEMIDFFCANSDAIAKITLAPERNKPEHIRQ
LVEAGILVSAGHTAANYDQAMAGFDDGIRFATHLYNAMTPTVNGREPGVVGAIYDRKDVY
AGVIVDGHHVHWANVRLAHKMLGERLVLVTDATAPAGAPEGFEKFDFCGATVYFRDGQCV
DENGTLGGSALTMIEGVENLVKQVGLPLDEVLRMATLYPARAIGWDSRLGSIQVGKIANL
TVFDQTFTVCGTVVNGHYTTQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcattgaccaattgcaccctctacaccggcagctgtgtgctgaccggttacggg
gtcgtgatcgagggcgacaagattgtcgccatccagcgtcaggctgagctgcctgccggc
atagagcgacatgatctgcacggcgccaacctgagcgccggttttatcgacgtgcagctc
aacggctgtggcggcgtcatgttcaacaccgacatctccacagagacactggcgatcatg
caggccgccaacctcaaatccggtaccaccagcttcctgccgaccctgatcaccagcccg
gattcggacatgaagcgggccgtcgccgtgacccgcgattacatggccgcgcacccgaat
gaagtgctgggcgtgcatctggaaggtccctacaccaacctcaagcgcaaaggcatacac
ccggccgcccagatccgccagcccgccgacgagatgatcgacttcttctgcgccaacagc
gatgccatcgccaagatcaccctggcaccggagcgcaacaagcccgagcacatccgtcag
ctggtagaggcaggcatactggtctccgctggccataccgccgccaactacgatcaggcc
atggccggctttgatgacggcatccgttttgctacccacctctacaacgccatgaccccg
accgtgaacggccgcgagccgggtgtggtgggtgccatctatgatcgcaaggatgtctat
gctggcgtcatcgtcgatggacaccatgtgcactgggccaacgtacgactggcccacaag
atgctgggggagagactggtgctggtcaccgacgcgaccgcccccgccggtgcgccggaa
ggctttgagaagtttgatttttgtggcgcaaccgtctatttccgcgatggtcagtgcgtc
gacgagaatggtacactcggcggctctgccctcaccatgattgagggggtggagaatctg
gtcaaacaggtcggattaccgctcgatgaagtactgagaatggccactctttatcccgct
cgcgccattggatgggactcacgtctcggtagtatccaggtcggaaaaatagccaacctg
actgtctttgatcagaccttcacggtctgcgggaccgtggttaacggacactacacaaca
cagtga

DBGET integrated database retrieval system