KEGG   Aeromonas salmonicida O23A: O23A_p2454Help
Entry
O23A_p2454        CDS       T04990                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
aeo  Aeromonas salmonicida O23A
Brite
KEGG Orthology (KO) [BR:aeo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aeo03016]
    O23A_p2454
Enzymes [BR:aeo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     O23A_p2454
Transfer RNA biogenesis [BR:aeo03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    O23A_p2454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ARW83195
UniProt: A0A1Z1NR62
Position
complement(2638948..2639688)
Genome map
AA seq 246 aa AA seqDB search
MKLTLLYQDDWLVAVNKPSGLLVHRSWLDKAETRFAMQMTRDLIGGRHVYPVHRLDRPTS
GVLLFALDPAVARILTEAFAARQVHKEYLALVRGWAPEQGVIDYPLKEQLDKIADSMSNP
DRPAQEAVTAFRCLHQVELPHAVSKKHPTSRYSLVKLFPKTGRKHQLRRHMEHLFHPIVG
DTTHGDGRHNRFFREHFGCERLLLVARTLSFEHPILKVPMRIQAPLGPDLLQLFAELGWP
GSESDY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgactctgctctatcaggatgattggttggtagcggtcaacaaaccctccggt
ctgctggtgcaccgcagctggctcgacaaggccgagacccggttcgccatgcagatgacc
cgggatctgatcggggggcgccatgtctaccccgtgcatcgcctcgatcgccccacctcg
ggcgtgctgctgtttgctctggatcctgccgttgcccgtatcctgacagaggcctttgcc
gcccggcaggtacacaaggagtatcttgcgctggtgcggggctgggccccggagcagggg
gtgatcgactaccccctcaaggagcagctggacaagatcgccgattccatgagcaatcct
gatcgcccggcccaggaggcggtaacggcatttcgttgcctgcatcaggtcgaactgccc
catgcggtttccaagaagcaccccaccagtcgctatagtctggtcaagttgttcccgaaa
accggtcgcaagcatcagttgcgccgccatatggaacatcttttccacccaatagtgggc
gataccactcatggtgatggtcgccacaatcgcttctttcgggaacacttcggctgcgaa
cgcctgctgctggtagctcgtactctcagcttcgagcacccgatcctcaaggtcccgatg
cggatccaggcgccgctgggtcctgatctattgcagctgttcgccgagctgggctggcct
ggcagtgaaagtgactactga

DBGET integrated database retrieval system