KEGG   Altererythrobacter epoxidivorans: AMC99_00478Help
Entry
AMC99_00478       CDS       T04070                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase, Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aep  Altererythrobacter epoxidivorans
Pathway
aep00071  Fatty acid degradation
aep00072  Synthesis and degradation of ketone bodies
aep00280  Valine, leucine and isoleucine degradation
aep00310  Lysine degradation
aep00362  Benzoate degradation
aep00380  Tryptophan metabolism
aep00620  Pyruvate metabolism
aep00630  Glyoxylate and dicarboxylate metabolism
aep00640  Propanoate metabolism
aep00650  Butanoate metabolism
aep00900  Terpenoid backbone biosynthesis
aep01100  Metabolic pathways
aep01110  Biosynthesis of secondary metabolites
aep01120  Microbial metabolism in diverse environments
aep01130  Biosynthesis of antibiotics
aep01200  Carbon metabolism
aep01212  Fatty acid metabolism
aep02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMC99_00478
   00630 Glyoxylate and dicarboxylate metabolism
    AMC99_00478
   00640 Propanoate metabolism
    AMC99_00478
   00650 Butanoate metabolism
    AMC99_00478
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AMC99_00478
   00072 Synthesis and degradation of ketone bodies
    AMC99_00478
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMC99_00478
   00310 Lysine degradation
    AMC99_00478
   00380 Tryptophan metabolism
    AMC99_00478
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AMC99_00478
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMC99_00478
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AMC99_00478
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aep04147]
    AMC99_00478
Enzymes [BR:aep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AMC99_00478
Exosome [BR:aep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMC99_00478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2967
Motif
Other DBs
NCBI-ProteinID: ALE15789
UniProt: A0A0M4M681
Position
452571..453752
Genome map
AA seq 393 aa AA seqDB search
MRDAVIVSTARTPLAKSMRGAFNATHPVQLGAWSVEAAVERAGLSGGEIDDVIIGAASQG
GAQGFNMGRQIALRAGLPVEVSGMTMDRQCSSGLMSIATAAKQIIVDRMDICVAGGVESI
TSLRSGGGQPPQRDEELLKMHPDIFMPMIGTAEVVAKRYGISREAQDEYSLQSQQRTAAA
QQSGKLADEIIEVSTTMAVKDKETGKISQREVTISMDDCNRPNTTLEGLASLDPVMGEGH
TVTAGNASQLADGSSASVLMEAKVAEQRGLQPLGRYVGMAVAGTKPDEMGIGPVFAIPKL
LQRFDLGMDDIGLWELNEAFAVQVLYCRDKLGIPDEKLNVNGGSISIGHPFGMTGARCVG
HALIEGKRRGEKYVVVTMCVGGGMGAAGLFEVL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacgcagttatcgtatcgacggcacgtacgccgctcgccaaatccatgcgtggg
gcgttcaacgcgactcacccggtccaactgggtgcgtggtcggtagaagctgcggtcgag
cgcgcaggtctttcgggtggagagatcgacgatgtgatcatcggcgcggccagccagggc
ggggcgcaaggcttcaacatgggccgccagatcgcgcttcgcgccggtctcccggtcgaa
gtttcaggcatgacgatggacaggcagtgttcttcgggcctgatgtccattgcaaccgca
gcaaagcagatcatcgtcgatcgcatggatatctgtgtcgctggcggggtcgaatcgatc
acctcgctacgctccggtggtggccagccgccccagcgcgacgaagaactgctcaaaatg
catcccgatatcttcatgccgatgatcggcaccgccgaagtcgtcgccaagcgctatggc
atcagccgcgaagcgcaggacgaatattcgctccagtcgcagcagcgcactgccgcagcc
cagcaatcgggcaagctcgctgacgaaatcatcgaagtcagcaccaccatggcggtgaag
gacaaggaaaccggcaagatttcgcagcgcgaggtcaccatttcgatggacgactgtaac
cgccccaacacgaccctcgaagggctcgcatcgctcgatccggtgatgggcgaagggcac
accgtaacagcaggcaacgcgagccagttggcggatggttcgtcggccagcgtcctcatg
gaagcgaaggtcgccgaacagcgcggcctccagccgctgggccgctacgtcggcatggcg
gtcgcgggcaccaagcctgatgaaatgggtatcggacccgtattcgccattccgaagctg
ctccagcggttcgacctcggcatggacgatatcggcctgtgggagctcaacgaggccttt
gccgtgcaggtgctctactgccgcgacaagctcggcatccccgacgaaaaactgaacgtg
aatggcggctcgatctcgatcggccaccccttcggtatgacgggtgcccgctgcgtcggc
cacgcgctgattgaagggaagcgtcgcggcgagaaatacgtcgtcgtcacgatgtgcgtc
ggtggcgggatgggcgctgcgggcctgttcgaggtactctga

DBGET integrated database retrieval system