KEGG   Altererythrobacter epoxidivorans: AMC99_02363Help
Entry
AMC99_02363       CDS       T04070                                 

Definition
(GenBank) Phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
aep  Altererythrobacter epoxidivorans
Pathway
aep00360  Phenylalanine metabolism
aep00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aep00790  Folate biosynthesis
aep01100  Metabolic pathways
aep01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AMC99_02363
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMC99_02363
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AMC99_02363
Enzymes [BR:aep01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     AMC99_02363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ALE17638
UniProt: A0A0M4MXI3
Position
2331475..2332434
Genome map
AA seq 319 aa AA seqDB search
MVAIETMATIAEQQQDFSILPELPADVFTAPLKKPAHVGDDWLEPKQTEYTSDDDAIWND
LFARQMEVLPGRAASAFMAGLQKLNLNRGGVPEFRKLSEDLGALTGWSVVPVPMLIPDHV
FFWHLANRRFPAGNFIRTRETFDYIQEPDVFHDVFGHVPMLTDPVYADYMQEYGRAGWKA
MRYNHLKALGALYWYTVEFGLIEEAPGDIRAYGAGILSGPTEAVFSVEADSPNRIMLNVD
RVMRTDYVIDDLQPTYFVIESFEDLYRQTVERDFDRLYRSLGPSFTYANSAVIDVDDVLH
RGTQEYWLRGGRGSGATPI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaattgaaactatggctacgatcgcagaacaacagcaggacttttcgatcctg
cccgaattgccggccgatgtcttcaccgcgccgctgaaaaaacccgcgcatgtcggtgac
gactggctggagccgaagcagaccgaatacacttcagatgatgatgcgatctggaacgac
ctctttgcgcggcagatggaagtgctccccggacgggcggcaagcgcgttcatggccgga
ttacagaaactcaatctcaaccgcggcggcgtgcccgaattccgcaagctcagcgaggat
ctcggcgcgctcaccggatggagcgtcgtcccggtaccgatgctaatccccgatcacgtg
ttcttctggcaccttgccaaccgccgttttcctgccggcaatttcattcggacacgcgag
actttcgattacatccaggagccggatgtctttcacgacgtcttcggccacgtgccgatg
ctgaccgacccggtctatgccgattacatgcaggagtatggccgcgccggctggaaagcc
atgcgctacaaccatctaaaggcccttggagcgctatactggtacacggtcgaattcggc
ctgatcgaggaagcgccgggcgatatcagggcctatggcgcaggcatcctgtccggaccg
acagaggctgttttttcggtggaagcagacagccccaaccgcatcatgctgaacgtcgac
cgggtcatgcgcacggattacgtgatcgacgatcttcagccgacctatttcgtcatcgaa
agcttcgaagacctttaccgccagacggtcgagcgcgacttcgatcgcctgtaccgcagc
cttggtccgagcttcacatatgccaattcggcagtgatcgacgtcgacgacgtgctccac
cgcgggacgcaggaatactggttgcgcggaggacgtggaagcggcgcgacgccgatctag

DBGET integrated database retrieval system