KEGG   Adlercreutzia equolifaciens: AEQU_0619Help
Entry
AEQU_0619         CDS       T02875                                 

Definition
(GenBank) phosphate transporter protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
aeq  Adlercreutzia equolifaciens
Brite
KEGG Orthology (KO) [BR:aeq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AEQU_0619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: BAN76588
Position
complement(831311..832357)
Genome map
AA seq 348 aa AA seqDB search
MELTLSVFLSQAGDHPVLLGILALVIGVTIISGATDAPNAIASAVSTRCLTPGAALALAA
VFNFVGLVGMTYISTAVAHTMFNMVDFSGNTHQALLALIAAMIGSIGWGVFCWFWGIPAS
KSHSLIAGVTGGAIALNGLAGVVLSEWMLVIYGMVFSLVGGFILGMATTKIIEFLFSRVN
RQRGNKVCMVLQDICACALSFLHGAQDGQKFMSIGLLGIALAFGMETSGATDFPLWLMII
CSAAMSLGTLLGGKRIIKSVAMDMVSLEKYQGVAASISTVITLFVASMTGMPVSTSHCST
ASIMGVGASKSFRRVNWGVARRMVWAWVLTFPCCGFIGWALAKLFMML
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggaattgactctttcggtgttcctctcgcaggcaggagaccatccggtcctgctcggc
attctggcgctggtcatcggtgtgaccatcatctcgggcgccaccgacgcccccaacgcc
atcgccagcgcggtctccacccgctgtctcacccccggcgcggcgctcgcgctggccgcc
gtgttcaacttcgtgggcctggtgggcatgacctacatctccaccgccgtggcccacacc
atgttcaacatggtcgacttctccggcaacacccaccaggcgctcctcgcgctcatagcc
gccatgataggctctatcggctggggcgtcttctgctggttctggggcatccccgccagc
aagtcccactcgctcatcgccggcgtcaccggcggggccatcgcgctgaacgggctggcc
ggtgtcgtgctctccgagtggatgctcgtcatctacggcatggtgttctcgctggtgggc
ggcttcatcctcggcatggcgaccaccaagatcatcgagtttctcttctcccgcgtcaac
cgccagcgcggcaacaaagtgtgcatggtgctgcaggacatctgcgcctgcgcgctgtcg
ttcctccacggcgcccaggacgggcagaagttcatgtccatcggacttttgggcatcgcg
ctcgccttcggcatggagacaagcggcgccaccgacttccccctgtggctcatgatcatc
tgctcggcggcaatgtctctgggcacgctgctcggcggcaagcgcatcatcaaatcggtg
gccatggacatggtctcgctggagaagtaccagggcgtggcggcctccatctctaccgtg
atcacgctgttcgtggcctcaatgaccggcatgcccgtctccacctcccactgctccacc
gcctccatcatgggcgtgggcgcatcgaagagcttccgccgcgtgaactggggcgtcgcc
cgccgcatggtatgggcctgggtgctcaccttcccctgctgcggcttcatcggctgggcc
ttggccaagctgttcatgatgctgtaa

DBGET integrated database retrieval system