KEGG   Adlercreutzia equolifaciens: AEQU_1861Help
Entry
AEQU_1861         CDS       T02875                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate/cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
aeq  Adlercreutzia equolifaciens
Pathway
aeq00770  Pantothenate and CoA biosynthesis
aeq01100  Metabolic pathways
Module
aeq_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:aeq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AEQU_1861
Enzymes [BR:aeq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     AEQU_1861
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     AEQU_1861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: BAN77830
Position
complement(2356726..2358180)
Genome map
AA seq 484 aa AA seqDB search
MSVERPCVLVGVTGCIAAYKAGEIVRGLQKAGVRVKVVMTEHGTHFVDPVTFRALTHEKV
AVDLFDDPSDPIHHISLAQECDVFLIAPCTANVMAKVACGIADDLLSTTALATTATLAIA
PAANVHMYEAAATQENMATLRRRGVRFIEGGAGYLACGDVGRGRLADPAVIVRETLALLA
ERVGLDALREACEQHGEVPFATVMEQIDAARASASASSTEDAAASASAPCYPEQSAEGSE
SKDLPTAAAPDTPLPAAVADGAATMPAGALAGRTVLVTAGPTVEPIDSVRYISNYSSGKM
GYAIAEAAAAAGARVVLVSGPVALAAPDGVEVVPVKTARDMLAAASSVFPAADAAIFAAA
VADLRPANPADRKLKKGRDDAALANVPLTENPDILATLAAGKRPDQYVVGFAAETNDVLM
NAHAKLKKKNADMIVANQVGDGLAFGTDNNEVWLVTEGDDVLLPLMSKRAVAERLVEVVA
AHLE
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtggagcggccttgcgtattggtgggagtgaccgggtgcattgcggcctacaag
gccggggaaatcgtgcgcgggctgcagaaggcgggcgtgcgggtgaaggtggtcatgacc
gagcacggcacgcacttcgtcgaccccgtgaccttccgggcgcttacccacgagaaggtg
gcggtggatctgttcgatgacccgtccgaccccatccaccatatctcgctcgctcaggaa
tgcgacgtgttccttatcgcgccgtgcacggccaatgtaatggcgaaggtggcctgcggc
attgccgacgacttgctttccacgacggccctggcgaccacggcgacgctggccatcgcg
ccggcggccaacgtgcatatgtacgaggcggcggccacccaggagaacatggccacgctg
cgccgccggggcgtgcgcttcatcgaagggggcgcgggctatctggcctgcggcgatgtg
ggtcgcggtcgtttggccgatcccgctgtcatcgtgcgcgagacgctggccctgttggcc
gagcgcgtgggcttggacgccctgcgggaggcctgtgagcagcacggtgaggtgccgttc
gcgaccgtgatggagcagatcgatgctgcgcgcgcgtcggcttctgcgtcttccactgag
gacgctgccgcaagcgcttccgccccgtgctatcccgagcagagcgccgaaggctcggag
tcgaaggatctcccaactgctgccgctcccgacaccccgctgccggccgccgtggccgat
ggcgcggccaccatgcccgcgggcgcgctcgctggtcgcacggtgcttgtgacggcgggc
cccacagtggagcccatcgactcggtgcgctacatttctaattactcctcgggcaagatg
ggctatgccatcgccgaggccgctgcggctgccggcgcgcgggtggtgctcgtgtcgggc
ccggtggccctcgccgcacctgatggcgtggaagtggtgcccgtgaagacggcccgcgac
atgctggctgccgcctcatccgtgttcccggctgccgacgctgccatcttcgccgccgct
gtggccgacctgcgcccggcgaacccggccgaccgcaagctgaagaagggccgcgacgat
gcggcgctcgccaacgtacctctcacggagaaccccgacatcctggccactctggccgcg
ggcaagcgtcccgatcagtatgtggtgggcttcgccgccgagaccaacgacgtgctcatg
aacgcccatgccaagctcaagaagaagaacgctgacatgattgtggccaaccaggtgggc
gacggcctcgccttcggcaccgacaacaacgaggtgtggctcgtcacggaaggcgacgac
gtgcttctgcccctcatgagcaaacgcgccgtagccgagcgcctcgtggaagtggtggcc
gcgcatctggaatag

DBGET integrated database retrieval system