KEGG   Aeromicrobium erythreum: AERYTH_09780Help
Entry
AERYTH_09780      CDS       T04236                                 

Definition
(GenBank) hypothetical protein
Organism
aer  Aeromicrobium erythreum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ALX04969
UniProt: A0A0U4BAR2
Position
2074803..2075300
Genome map
AA seq 165 aa AA seqDB search
MQLRPARDDCGSWHVRRPGPFAVTYWLLSNTVTNLFDAFLGGTLHVWSLFPGARHDGYVG
MLDVTEGERVVAPGLRGFRWVLEVTVDGLVLATVTTGSRTPIVLPHPVAVVVRPRYGVRR
SRLAHTPWRARLTLPSDKVVELVGPWFVLCHAARTLAWPSPTTAR
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
gtgcagctgcgtcctgctcgtgacgactgtggctcctggcacgtccggcgaccgggaccg
ttcgccgtcacgtactggctgctgagcaacaccgtcacgaacctgttcgacgcgtttctg
gggggcaccctccacgtctggagcctgttcccgggcgcgcgccacgacggctacgtcggg
atgctcgacgtcaccgagggcgagcgggtcgtggccccggggctgcgaggattcaggtgg
gtcctggaggtcacggtcgacggcctggtcctcgcgacggtcacgaccggttctcgcacg
ccaatcgtgctgccacaccccgtcgcggtcgtggtgcgcccgcgatacggggtccgccgt
tcccggctggcgcacacgccctggcgagcccggctgacgctcccctcggacaaggtcgtg
gagctggtcggcccctggttcgtgctctgccacgctgcccgaacgctcgcgtggccctcg
ccgacgaccgcgcgctga

DBGET integrated database retrieval system