KEGG   Aeromicrobium erythreum: AERYTH_09795Help
Entry
AERYTH_09795      CDS       T04236                                 

Definition
(GenBank) hydrolase
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Organism
aer  Aeromicrobium erythreum
Pathway
aer00620  Pyruvate metabolism
aer01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AERYTH_09795
Enzymes [BR:aer01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.6  hydroxyacylglutathione hydrolase
     AERYTH_09795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2 Lactamase_B_3
Motif
Other DBs
NCBI-ProteinID: ALX04972
UniProt: A0A0U4CQS2
Position
complement(2078482..2079192)
Genome map
AA seq 236 aa AA seqDB search
MLLTSFPAGPLQANCYVLAREAGAGCVVVDPGMDALDGVRQVVTEHDLRVEAVLVTHGHF
DHLWNAQDVAREFDAPVWIHPADRHLLSDPMAAISGPSAAMLRAQFGLHDPPEFVEPADV
RDAVDGAVIEVDGLSLSVDHVPGHTPGTVYYRVDWDGSGVSEGTVSQVMFSGDFLFAGSI
GRTDLTGGDHDQMLQSLREKVLPLRDDVVVLPGHGPQTSIGRERATNPFLAELQEG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctcacgtccttccccgccggccccctgcaggccaactgctacgtgctcgcccgc
gaggcgggtgccgggtgcgtcgtcgtcgacccgggcatggacgccctcgacggggtccgc
caggtcgtcaccgagcacgacctgcgcgtcgaggccgtcctcgtcacccacggtcacttc
gaccacctctggaacgcacaggacgtcgcacgcgagttcgacgcgccggtgtggatccac
cccgccgaccggcacctgctgagcgacccgatggcggcgatctccggaccgtccgccgcg
atgctgcgcgcgcagttcggcctgcacgacccgccggagttcgtcgagcccgccgacgtg
cgcgacgccgtcgacggtgccgtgatcgaggtcgacggcctgagcctcagcgtcgaccac
gtccccggccacacgcccggcaccgtctactaccgggtcgactgggacggcagcggcgtc
tccgaggggacggtgtcgcaggtgatgttctccggcgacttcctgttcgccggctcgatc
ggtcgcaccgacctgaccggcggcgaccacgaccagatgctgcagagcctgcgcgagaag
gtcctgccgctgcgcgacgacgtcgtcgtcctccccggtcacggcccgcagacgtcgatc
gggcgcgagcgcgccaccaacccgttcctcgccgagctgcaggagggctga

DBGET integrated database retrieval system