KEGG   Aeromicrobium erythreum: AERYTH_09810Help
Entry
AERYTH_09810      CDS       T04236                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
aer  Aeromicrobium erythreum
Pathway
aer00790  Folate biosynthesis
aer01100  Metabolic pathways
aer02020  Two-component system
Module
aer_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aer00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AERYTH_09810
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AERYTH_09810
Enzymes [BR:aer01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AERYTH_09810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N
Motif
Other DBs
NCBI-ProteinID: ALX04975
UniProt: A0A0U4C210
Position
complement(2082262..2083836)
Genome map
AA seq 524 aa AA seqDB search
MSSGEIDRRTVVRAAALAAATSGGVLLGGGPASARGVPALVRRGRPELTHGVQAGDVHAG
QATLWGRADRPARLVAEISRDPSFRRAVTVPGPRVTPDTDLTGQWTVRGLPPGTDVHYRL
RAVDLHDPRRSGRPVSGRLRTLGGRRRDVRFLWSGDVAGQGWGVNPDVGGFRIADAMARR
DADFFLCSGDTVYADGPVQASVPLSDGRTWTNLVTEEKSKVAETLAEYRGQYRYNLEAEN
WRAFLASTAQVTQWDDHEVTNNWYPGEVLDDARYTERRVDVLAARARRAFHDYVPVAEIS
PDRVGRVYRVLHQGPLLDVFVLDMRTHKDPNTANDETSGDGGVLGAEQTRWLLRELRASR
ATWKVIAADLPIGLVVPDGSSAQEGLAQGDAGAPRGREIDIAQVLTALQDAGIRNHVWLT
ADVHYTAAHHYSPDRAAYQRFDPFWEFVSGPLNAGAFGPNRLDATFGPRAEFVAAPPTPN
TGPADGFQFFGEVEIDAVTQALTVTLRDVEGRALYTRTLAPQRR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgggggagatcgatcgccgtaccgtcgtccgcgctgctgcgctcgccgctgcc
acttccggtggggtgctgctggggggtgggccggcgtcagcgcggggtgtgccggctctc
gtgcggcggggcaggcccgagctgacgcacggggtgcaggccggtgacgtgcacgcgggg
caggccacgctgtgggggcgggccgaccggccggcgcgactcgtcgcggagatctcgcgc
gacccctccttccggcgcgccgtgaccgtccctggtccgcgcgtcacgcccgacaccgac
ctcaccgggcagtggacggtgcgagggctcccgcccgggaccgacgtgcactaccggctg
cgggccgtcgacctgcacgacccgcgccgctcgggacgtcccgtctccggccggctccgg
acgctcggcggacggcggcgcgacgtccgcttcctgtggtccggcgacgtcgccggacag
ggctggggcgtcaaccccgacgtgggcggcttccgcatcgccgacgcgatggcccgccgc
gacgccgacttcttcctctgcagcggcgacaccgtgtacgccgacggtcccgtgcaggcg
tccgtgccgttgtcggacggccggacgtggacgaacctcgtcacggaggagaagtcgaag
gtcgccgagaccctcgccgagtaccgaggccagtaccgctacaacctggaggcggagaac
tggcgcgcattcctggcgagcaccgcgcaggtgacgcagtgggacgaccacgaggtcacc
aacaactggtaccccggcgaggtcctcgacgacgcgcggtacaccgagcgtcgcgtcgac
gtgctggcggcgcgggcgcggcgcgcgttccacgactacgtgcccgtcgccgagatctcg
cccgaccgggtcggccgggtctaccgcgtcctgcaccaaggaccgctgctcgacgtcttc
gtcctcgacatgcgcacccacaaggacccgaacacggccaatgacgagacctcgggcgac
ggaggggtgctcggcgccgagcagacccgctggctgctgcgtgagctgcgcgcctcccgc
gccacgtggaaggtcatcgcggcggacctgccgatcgggctggtcgtgcccgacggcagc
agcgcgcaggagggtctggcccagggcgacgccggggcgccgcgcggtcgcgagatcgac
atcgcgcaggtcctcacggcgctgcaggacgccggcatccgcaaccacgtgtggctcacg
gccgacgtgcactacacggcggcgcaccactactcgcccgaccgggccgcctaccagcgt
ttcgacccgttctgggagttcgtgtccggcccgttgaacgccggtgccttcggaccgaac
cggctcgacgcgacgttcggtccgcgcgcggagttcgtcgccgccccgccgacgcccaac
accggaccagcggacgggttccagttcttcggcgaggtcgagatcgacgccgtcacgcag
gcgctgaccgtcacgctgcgcgacgtcgagggacgggcgctctacacccgcacgctcgca
ccgcagcgccgctga

DBGET integrated database retrieval system