KEGG   Aeromicrobium erythreum: AERYTH_10030Help
Entry
AERYTH_10030      CDS       T04236                                 

Definition
(GenBank) hypothetical protein
Organism
aer  Aeromicrobium erythreum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ALX05014
UniProt: A0A0U4CPJ4
Position
complement(2128083..2128508)
Genome map
AA seq 141 aa AA seqDB search
MRRRLVAVAVVPLLLLTACGGSDGGSAPIATEPGPAESASGAQGEALEQAVVRYVDAFHG
GRADDAYASLSARCRQELPFAEFQRMTRQATELDGDDPLRDVEVTADGARGSVSYELDVE
SLSQRDQPWVREDGTWRNDDC
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtcgtctggtcgcggtcgcggtggtccccctgctgctcctgacggcctgcggc
gggtccgacggcgggtccgcgccgatcgccacggagccggggccggcggagtcggcgtcg
ggtgcgcagggtgaggcgctcgagcaggccgtcgtccgctacgtcgacgccttccacggc
ggtcgcgccgacgacgcgtacgcgtccctgtccgcgcggtgccgtcaggagctgccgttc
gccgagttccagcggatgacgcgccaagccaccgagctcgacggtgacgaccccctgcgc
gacgtcgaggtgacggccgacggcgcgcgcggttcggtgtcgtacgagctcgacgtcgag
tcgttgtcgcagcgggaccagccctgggtccgcgaggacggcacctggcgcaacgacgac
tgctga

DBGET integrated database retrieval system