KEGG   Aeromicrobium erythreum: AERYTH_10070Help
Entry
AERYTH_10070      CDS       T04236                                 

Definition
(GenBank) phosphate:nucleotide phosphotransferase
Organism
aer  Aeromicrobium erythreum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PPK2
Motif
Other DBs
NCBI-ProteinID: ALX05021
UniProt: A0A0U4CWB8
Position
complement(2135761..2136594)
Genome map
AA seq 277 aa AA seqDB search
MSQSLSSTLSAVSSLAEVDSRSTPGFDGDKAAGKAALAELGTELADLQERLHAHGTTGDP
RSVLVVLQGMDTSGKGGTIEKVVGLVSPLGVRIASFKKPTPEELAHDFLWRVERRLPSAG
ELGVFDRSHYEDVLIGRVRRLADVDEVERRYDAINAFERRYVESGGTVLKCLLHISPDDQ
AARLLARLDDPTKHWKFNPGDIDERELWDDYQDAYDLVLQRTSTDVAPWHVVPSGRKWYR
NWAVGRLLLEHLRALDLTWPEADYDVDEQRARLAASS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagagcctgagcagcacgctgtccgccgtcagcagcctcgccgaggtcgactcc
cgctcgacccccggcttcgacggcgacaaggcggccggcaaggccgcgctcgccgagctc
ggcaccgagctggccgacctgcaggagcgtctgcacgcgcacggcacgacgggcgacccg
cgctccgtcctggtcgtgctgcagggcatggacacctcgggcaagggcggcacgatcgag
aaggtcgtcggtctggtcagcccgctcggggtccgcatcgcctccttcaagaagccgacg
cccgaggagctcgcccacgacttcctgtggcgggtcgagcgacggttgccgtcggccggc
gagctcggcgtcttcgaccgctcccactacgaggacgtgctcatcgggcgcgtgcgccgg
ctggccgacgtcgacgaggtcgagcgacgctacgacgcgatcaacgccttcgagcgccgg
tacgtcgagtccggcggcacggtcctcaagtgcctgctgcacatcagtcccgacgaccag
gccgctcgactcctcgcccggctcgacgacccgacgaagcactggaagttcaacccgggc
gacatcgacgagcgtgagctgtgggacgactaccaggacgcgtacgacctggtgctccag
cggacgtcgaccgacgtcgccccgtggcacgtcgtgcccagcggacgcaagtggtaccgc
aactgggcggtcggccggctgctcctggagcacctgcgcgcgctggacctgacctggccc
gaggccgactacgacgtcgacgagcagcgcgcccggctcgctgcgtcgagctga

DBGET integrated database retrieval system