KEGG   Aeromicrobium erythreum: AERYTH_10090Help
Entry
AERYTH_10090      CDS       T04236                                 

Definition
(GenBank) hypothetical protein
Organism
aer  Aeromicrobium erythreum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chlor_dismutase
Motif
Other DBs
NCBI-ProteinID: ALX05025
UniProt: A0A0U4BII3
Position
complement(2138901..2139605)
Genome map
AA seq 234 aa AA seqDB search
MSVPNQGKLAKEINETIRYTMWSVFKLERVLGDADRAAEAAEVDDLVKRLADEDVVVRGF
YDVSGMRADADLMVWWHASSADALQAAYNAFRRTALGSRMAPVWSQTALHRPAEFNKSHV
PAFMADETVRDWVCVYPFVRSYEWYLLPDEERRAMLKEHGMQARPYPDVRANTVASFALG
DYEWILAFEADELHRIVDLMRDLRASTARRHVREEIPFYTGRRHDPADLTALWP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgccgaaccagggaaagctggccaaggagatcaacgagaccatccgctacacg
atgtggtcggtcttcaagctcgagcgggtgctcggggacgccgaccgtgccgcggaggcc
gccgaggtcgacgacctggtgaagcgtctggccgacgaggacgtcgtggtccgcggcttc
tacgacgtcagcggcatgcgcgccgacgccgacctcatggtctggtggcacgcgtcgtcg
gccgacgcgctgcaggccgcctacaacgcgttccggcggaccgcgctgggctcgcggatg
gcgcccgtgtggtcgcagaccgccctgcaccgtcctgcggagttcaacaagtcgcacgtg
cccgcgttcatggccgacgagaccgtgcgcgactgggtctgcgtgtacccgttcgtccgc
tcctacgagtggtacctgctgcccgatgaggagcgtcgcgcgatgctcaaggagcacggc
atgcaggcccgcccctaccccgacgtccgcgccaacacggtcgcgtcgttcgcgctcggc
gactacgagtggatcctggcgttcgaggccgacgagctgcaccgcatcgtcgacctcatg
cgcgacctgcgcgccagcaccgcccgccgccacgtgcgcgaggagatcccgttctacacc
ggccgccgccacgacccggccgacctcaccgcgctctggccctga

DBGET integrated database retrieval system