KEGG   Aeromicrobium erythreum: AERYTH_10110Help
Entry
AERYTH_10110      CDS       T04236                                 

Definition
(GenBank) 3'-5' exonuclease
  KO
K03684  ribonuclease D [EC:3.1.13.5]
Organism
aer  Aeromicrobium erythreum
Brite
KEGG Orthology (KO) [BR:aer00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aer03016]
    AERYTH_10110
Enzymes [BR:aer01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.5  ribonuclease D
     AERYTH_10110
Transfer RNA biogenesis [BR:aer03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    AERYTH_10110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_A_exo1 DNA_pol_A_exoN HRDC
Motif
Other DBs
NCBI-ProteinID: ALX05029
UniProt: A0A0U4CI12
Position
2142662..2143888
Genome map
AA seq 408 aa AA seqDB search
MPEETGSPEEQAPPLPRLQLRDPLPPVIDTVDDYVAYCARLALGHGPVALDAERASGYRY
SQRAYLVQVRRDGSGTGLVDPIAFDDLVDLDEAIGDAEWILHAATQDLPCLAEVGLHPTA
LFDTELAGRLLNLPRVGLASLVEHYLGLSLAKEHSAADWSTRPLPEPWLEYAALDVEVLI
ELRNLIEADLERAGKREWAAQDFEALLSFTGAPPKEERWRRTSGIHRARGRRTLGLVRAL
WEARDRIAEQRDTTPGRILPDASILEIAREAPRDASTLRNLPVMRSRGPRRFLQQWLDAV
EEGLALPDDALPLSTQHREGPPPPRAWADKHPEAAARLTSAREAVTRIAEQHDLPPENLI
SPGLVRGLAWDPPTVVDVVHVGDALTEGGARPWQVELVAADLVDALTP
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaggagacggggagcccggaggagcaggctcctcctcttccacgtctgcagctg
cgtgaccccctgccccccgtcatcgacacggtcgacgactacgtggcctactgcgcgcgt
ctcgcgctcggccacggtccggtggccctcgacgccgagcgggcgtcgggctaccgctac
tcccagcgggcctacctcgtgcaggtgcgccgcgacggcagcggcaccggcctggtcgac
cccatcgccttcgacgacctcgtcgacctcgacgaggcgatcggcgacgcggagtggatc
ctgcacgcggccacgcaggacctgccgtgcctcgccgaggtcgggctgcacccgaccgcc
ctgttcgacaccgagctcgccggccggctgctcaacctcccgcgcgtgggcctggcctcc
ctcgtggagcactacctcgggctgagcctggccaaggagcactcggccgccgactggtcg
acgcgaccgctgccggagccctggctcgagtacgccgcgctcgacgtcgaggtgctcatc
gagctgcgcaacctcatcgaggccgacctcgagcgcgccggcaagcgcgagtgggccgcg
caggacttcgaggccctcctgtcgttcacgggggctccgccgaaggaggagcgctggcgg
cgcacgtcggggatccaccgggcccgtggccgacgtaccctcgggctggtgcgcgccctc
tgggaggcgcgcgaccggatcgccgagcagcgcgacacgacgcccgggcggatcctgccc
gacgcctccatcctcgagatcgcccgcgaggctccccgcgacgcctcgacgctgcgcaac
ctgcccgtcatgcgctcgcgcggaccgcgccgcttcctgcagcagtggctcgacgcggtc
gaggagggcctcgccctccccgacgacgccctgccgctctccacgcagcaccgcgagggg
ccgcccccgccgcgcgcgtgggccgacaagcaccccgaggccgcggcgcggctgacatcg
gcccgcgaggcggtcacgcgcatcgccgagcagcacgacctgccgccggagaacctcatc
tcccccggcctcgtccgcggtctggcctgggacccgccgaccgtcgtcgacgtcgtccac
gtcggcgacgcgctcaccgagggcggggcccgtccgtggcaggtcgagctcgtcgccgcc
gacctcgtcgacgccctgacgccctga

DBGET integrated database retrieval system