KEGG   Aeromicrobium erythreum: AERYTH_10130Help
Entry
AERYTH_10130      CDS       T04236                                 

Definition
(GenBank) hypothetical protein
Organism
aer  Aeromicrobium erythreum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ALX05033
UniProt: A0A0U4BAX6
Position
2146721..2147047
Genome map
AA seq 108 aa AA seqDB search
MPGPRRTLAAALSAAVVGLFLVAGIGATHAGAHQRATTTHTSAASSHQAAHVKASGQHVD
QHHLDLWALPPESAPVAPVLARDTVVDAGVAVVESEAPAAAGRGPPTA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgcccggaccccgccgcacgctggctgccgccctgagcgcggccgtcgtcgggctgttc
ctcgtggccgggatcggcgccacccacgcgggggcgcaccagcgggccacgacgacgcac
acctcggctgcgtcgagccaccaggcggcgcacgtgaaggcatcgggccagcacgtcgac
cagcaccacctcgacctctgggcgctgccgcccgagagcgcgcccgtcgccccggtcctc
gcccgcgacacggtcgtcgacgcaggggtcgccgtggtggagtccgaggcacccgccgcc
gcgggacgcggaccgccgacggcctga

DBGET integrated database retrieval system