KEGG   Aeromicrobium erythreum: AERYTH_10705Help
Entry
AERYTH_10705      CDS       T04236                                 

Definition
(GenBank) AsnC family transcriptional regulator
Organism
aer  Aeromicrobium erythreum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AsnC_trans_reg NapD GYD
Motif
Other DBs
NCBI-ProteinID: ALX05136
UniProt: A0A0U4AXR4
Position
2278192..2278467
Genome map
AA seq 91 aa AA seqDB search
MITAIVFIQAEVSRLSETAAQIADLDGVSEVYSVTGDLDLVAMVRVPRIDDVSAVVADRL
NKVDGVLSTQTQIAFQTFSRHDLEDAFSIGL
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaccgccatcgtcttcatccaggccgaggtgtcccggctgtccgagaccgccgcg
cagatcgccgacctcgacggggtgagcgaggtgtactccgtcacgggcgacctcgacctc
gtcgcgatggtgcgggtgccgcggatcgacgacgtctccgcggtcgtcgccgaccggctc
aacaaggtcgacggcgtgctgtcgacgcagacgcagatcgcgttccagaccttcagccgg
cacgacctcgaggacgcgttcagcatcgggctctga

DBGET integrated database retrieval system