KEGG   Aeromicrobium erythreum: AERYTH_10710Help
Entry
AERYTH_10710      CDS       T04236                                 

Definition
(GenBank) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
aer  Aeromicrobium erythreum
Pathway
aer00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aer01100  Metabolic pathways
aer01110  Biosynthesis of secondary metabolites
aer01130  Biosynthesis of antibiotics
aer01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aer00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AERYTH_10710
Enzymes [BR:aer01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     AERYTH_10710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ALX05137
UniProt: A0A0U4BIU6
Position
complement(2278480..2279526)
Genome map
AA seq 348 aa AA seqDB search
MSARTWPDVLDELVGGRDLDSGSTAWAMAAILEGESTPAQIAAFAVALRAKGISQAELQG
LVDALLSHAVLVDVPGRVVDIVGTGGDRAKTVNISSMSAVTAAGAGAPVVKHGNRAASSQ
SGTADVFQVLGVRLDVRAASVPAVLERAGITFCFAPLFHPGLRFTGPPRREIGIATPFNV
LGPLVNPARPQASAVGCSDLRTAPLMAQVFADRGDDAFVFRGDDGLDEITTTTTTRVWTV
VGAGVVEEVLDPRELGFSLSSPEALRGGDPVHNADVFRRILDGEVSPVRDAVLLNAGAAL
AAYDGGSGPLLERLAAGVERARASIDSGAARDVLARWSAVTQELAPTD
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgcgcacctggcccgacgtgctcgacgagctcgtcggaggccgcgacctggac
tccgggtcgaccgcgtgggcgatggcggcgatcctcgagggcgagagcacgccggcgcag
atcgccgcgttcgcggtggcgctgcgcgcgaagggcatctcccaggccgagctgcaggga
ctcgtcgacgcgctgctgtcgcacgccgtcctcgtcgacgtccccggccgggtggtcgac
atcgtcggcacgggtggcgaccgggccaagacggtcaacatctcgtccatgtcggccgtc
acggcggccggtgcgggcgcccccgtcgtcaagcacggcaaccgcgccgcgtcgagccag
agcggcaccgccgacgtgttccaggtgctgggcgtgcggctcgacgtgcgggccgcgtcg
gtgccggcggtgctcgagcgcgccggcatcaccttctgcttcgccccgctgttccacccg
gggctgcgcttcaccggcccgccgcggcgcgagatcggcatcgccaccccgttcaacgtc
ctcggcccgctggtcaaccccgcgcgtccgcaggcgtcggcggtcgggtgctccgacctg
cgcacggcaccgctcatggcgcaggtcttcgccgaccgcggcgacgacgcgttcgtcttc
cgtggcgacgacggtctcgacgagatcaccacgacgaccaccactcgcgtgtggacggtc
gtgggcgccggcgtcgtggaggaggtgctcgacccgcgcgagctcgggttctcgctgtcg
tcgcccgaggcgctgcgcggcggcgaccccgtgcacaacgccgacgtgttccgccggatc
ctcgacggcgaggtctcgcccgtccgcgacgccgtgctgctgaacgcgggtgctgccctc
gcggcctacgacggcggcagcggaccgctgctggaacgcctggctgcaggtgtcgagcgg
gcgcgggcgtcgatcgactccggggccgcgcgcgacgtgctggcccgctggtccgctgtc
acgcaggagctggcaccgaccgactga

DBGET integrated database retrieval system