KEGG   Aeromicrobium erythreum: AERYTH_10795Help
Entry
AERYTH_10795      CDS       T04236                                 

Definition
(GenBank) hypothetical protein
Organism
aer  Aeromicrobium erythreum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3043 MAPEG
Motif
Other DBs
NCBI-ProteinID: ALX05154
UniProt: A0A0U4DAH1
Position
2295693..2296259
Genome map
AA seq 188 aa AA seqDB search
MTQENAAPDDRTQAAKKGRATPSRKEAEAARKKAMKTPMTRKEQMQRDRQARSDLRRRQQ
EALRAGKGDALPPRDRGPVRAFVRDYVDRRRNVAEYLLPILLAVLVLSFVQAPLAQLVVV
YAWGVMILLTILDEVLLVSGLRKQLKLRFPGESTRGATGYAVLRSTQLRRFRLPKPAIAR
GEEPRERV
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaggagaacgccgcccccgacgaccgcacccaggccgccaagaagggccgtgcg
acgccgagccgcaaggaggccgaggcggcgcggaagaaggcgatgaagacgccgatgacg
cgcaaggagcagatgcagcgcgaccgtcaggcgcgctcggacctgcgtcgtcgtcagcag
gaggccctgcgggccggcaagggcgacgccctccccccgcgcgaccgcggcccggtgcgc
gcgttcgtgcgtgactacgtcgaccgtcgtcgcaacgtcgccgagtacctgctgccgatc
ctgctcgcggtgctcgtcctcagcttcgtccaggcgccgctcgcgcagctcgtcgtcgtc
tacgcctggggcgtgatgatcctgctgaccatcctcgacgaggtcctgctggtcagcggc
ctgcgcaagcagctgaagctgcgcttcccgggcgagtcgacccgcggcgcgaccgggtac
gccgtcctgcgcagcacgcagctgcgccgcttccgcctgccgaagccggcgatcgcgcgc
ggcgaggagccgcgcgagcgcgtctga

DBGET integrated database retrieval system