KEGG   Aeromicrobium erythreum: AERYTH_10835Help
Entry
AERYTH_10835      CDS       T04236                                 

Definition
(GenBank) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aer  Aeromicrobium erythreum
Pathway
aer00020  Citrate cycle (TCA cycle)
aer00310  Lysine degradation
aer00380  Tryptophan metabolism
aer01100  Metabolic pathways
aer01110  Biosynthesis of secondary metabolites
aer01120  Microbial metabolism in diverse environments
aer01130  Biosynthesis of antibiotics
aer01200  Carbon metabolism
Module
aer_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aer_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AERYTH_10835
  09105 Amino acid metabolism
   00310 Lysine degradation
    AERYTH_10835
   00380 Tryptophan metabolism
    AERYTH_10835
Enzymes [BR:aer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AERYTH_10835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: ALX05161
UniProt: A0A0U4BBA3
Position
2303318..2305195
Genome map
AA seq 625 aa AA seqDB search
MATTVTLPELGESVTEGTVTTWLKNVGDTVEVDEPLLEISTDKVDTEIPSPVAGTILEIK
VEEDETVEVGADLAVIGDADESPSDGGGEAPAEPEETEDADVEEGSSDEASAEQPGEEPA
RESDGTPVNQHGEEPHLETQSTGEGTEVTLPELGESVTEGTVTTWLKAVGDTVEVDEPLL
EISTDKVDTEIPSPVAGTILEIKVEEDETVEVGAVLAVVGDPSAAGSSSGGSSDEAPSLD
SDPAEDPAQAEKLEEAAEAEKSQPEKAEEVTKEESAPAPSASAPTAQPEKQAHPENEARP
EPKQEAPQTSGASTQSGGDTYVTPIVRKLAKEHGVDLAAVTGSGVGGRIRKQDVLDAAKK
AEEAAAPAPAASAPSAPAPAASSEPSPLRGKTEKLSRLRKVVASRLTESLQISAQLTQVH
EVDVTEIARLRTKHKDAFLEREGVKLTFLPFFAKAAVEALKQYPTLNAALDLEAGTVTYP
AGEHLGIAVDTERGLLVPTIKDAGDLSIAGLARKIADAAERTRTNKIKPDELSGGTFSIT
NLGSNGALFDTPIINQPQVAILGVGAVVKRPVVITDAHGSDSIAVRSMAYLALTYDHRLI
DGADAGRFLTAVKERLQSGSFEGEL
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgaccgtcacccttcccgagctcggcgagagcgtcaccgagggcaccgtcacc
acctggctgaagaacgtcggcgacaccgtcgaggtcgacgagccgctgctcgagatctcc
accgacaaggtcgacaccgagatcccctcccccgtcgcgggcaccatcctcgagatcaag
gtcgaggaggacgagaccgtcgaggtcggcgccgacctcgccgtgatcggcgacgccgac
gagagcccgtccgacggcggcggcgaggccccggccgagccggaggagaccgaggacgcc
gacgtcgaggagggctcctccgacgaggcgtccgccgagcagcccggtgaggagccggcg
cgcgagagcgacggcaccccggtcaaccagcacggcgaggagccgcacctggagacgcag
tcgaccggcgagggcaccgaggtcacgctgcccgagctcggcgagagcgtcaccgagggc
accgtcaccacctggctcaaggccgtcggcgacaccgtcgaggtcgacgagccgctgctc
gagatctccaccgacaaggtcgacaccgagatcccctcccccgtcgcgggcaccatcctc
gagatcaaggtcgaggaggacgagaccgtcgaggtcggcgccgtgctggccgtcgtcggc
gacccgtccgccgcgggctcctcctcgggcggctcgtccgacgaggccccgtcgctcgac
agcgaccccgccgaggacccggcgcaggccgagaagctcgaggaggccgccgaggccgag
aagagccagcccgagaaggccgaggaggtcacgaaggaggagtcggctcccgccccgtcc
gcctccgccccgaccgcccagcccgagaagcaggcgcacccggagaacgaggcgcgtccc
gagccgaagcaggaggccccgcagacgtcgggcgcctcgacgcagagcggcggcgacacc
tacgtgacgccgatcgtgcgcaagctcgccaaggagcacggggtcgacctcgcggccgtc
accggcagcggcgtcggcggtcgcatccgcaagcaggacgtcctcgacgcagccaagaag
gccgaggaggccgcagcgcccgccccggccgcgtcggcgccctccgcccccgcgccggcc
gcgtcatcggagccgtcgccgctgcgcggcaagacggagaagctcagccggctgcgcaag
gtcgtcgcgtcgcgactcaccgagtcgctgcagatctcggcccagctcacgcaggtgcac
gaggtcgacgtcaccgagatcgcccgactgcgcaccaagcacaaggacgcgttcctcgag
cgtgagggcgtcaagctgacgttcctgccgttcttcgcgaaggcggccgtcgaggcgctc
aagcagtacccgacgctcaacgcggcgctcgacctcgaggccggcacggtcacgtacccg
gccggcgagcacctcggcatcgccgtcgacaccgagcgcggtctgctcgtgcccacgatc
aaggacgccggcgacctctcgatcgccgggctggcgcgcaagatcgccgacgcggccgag
cgcacccgcacgaacaagatcaagcccgacgagctgtccggtggcacgttctcgatcacg
aacctcggcagcaacggcgcgctgttcgacacgccgatcatcaaccagccgcaggtcgcg
atcctcggtgtcggtgctgtcgtcaagcgcccggtggtcatcaccgacgcgcacggcagc
gacagcatcgcggtgcgcagcatggcgtacctggcgctcacctacgaccaccgcctcatc
gacggtgccgacgccggtcggttcctgacggcggtcaaggagcggctgcagagcggctcc
ttcgagggcgagctctga

DBGET integrated database retrieval system