KEGG   Aeromicrobium erythreum: AERYTH_10955Help
Entry
AERYTH_10955      CDS       T04236                                 

Definition
(GenBank) hypothetical protein
Organism
aer  Aeromicrobium erythreum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ALX05184
UniProt: A0A0U4AXW3
Position
2328991..2329434
Genome map
AA seq 147 aa AA seqDB search
MSSDRQDRPATRHRRPDGVSDDTVEALGKLSEALEAVEEARGSLYAFHRLSGHADLQAGE
AADLLRDAGHGDLADRIESELVGRNVIEGRWTFQLVEEYDEGYYATFKDLERAARDGLVD
GRPHLFEAEMKEDRRTQGRRHHEATPG
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgaccgacaggaccgtcccgccacccgccaccgccgacccgacggcgtctcc
gacgacaccgtcgaggcgctcggcaagctcagcgaggccctcgaggccgtcgaggaggcg
cgcggctcgctgtacgccttccaccggttgtccgggcatgccgacctgcaggccggcgag
gccgccgacctcctgcgcgacgccggccacggcgacctcgccgaccgcatcgagtccgag
ctggtcggacgcaacgtcatcgaggggcgctggaccttccagctcgtcgaggagtacgac
gagggctactacgcgaccttcaaggacctcgagcgcgccgcccgcgacggcctggtcgac
ggtcgtccgcacctgttcgaggcggagatgaaggaggaccggcgcacccagggccgacgc
caccacgaggccacgccgggctga

DBGET integrated database retrieval system