KEGG   Aeromicrobium erythreum: AERYTH_10975Help
Entry
AERYTH_10975      CDS       T04236                                 

Definition
(GenBank) cyclase
Organism
aer  Aeromicrobium erythreum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polyketide_cyc Polyketide_cyc2
Motif
Other DBs
NCBI-ProteinID: ALX05188
UniProt: A0A0U4BBN2
Position
complement(2332712..2333170)
Genome map
AA seq 152 aa AA seqDB search
MSTITESVDVDVDVRTAYDQWTQFEDFPAFMEGVERIDQIDDTHLHWVVKVGPVTREFDA
TVTEQHPDERVAWTSDSGPEHAGVVTFHRLSDHATRVTVQMDVDPDGFVEEVADKAGLLD
RRTRGDLQRFKEFIERRGGEPTGAWRGEVERP
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgatcaccgagtccgtcgacgtcgacgtcgacgtgcgcaccgcgtacgaccag
tggacccagttcgaggacttcccggccttcatggagggcgtcgagcgcatcgaccagatc
gacgacacccatctgcactgggtggtcaaggtcggacccgtcacgcgcgagttcgacgcg
acggtcaccgagcagcaccccgacgagcgcgtcgcgtggacgtccgacagcgggccggag
cacgccggcgtcgtcacgttccaccggctctcggaccacgccacacgcgtgacggtgcag
atggacgtcgaccccgacggcttcgtcgaggaggtcgccgacaaggcgggcctgctcgac
cgacgcacccgtggtgacctccagcggttcaaggagttcatcgagcgtcgcggcggcgag
ccgaccggcgcgtggcgcggcgaggtcgagcgaccctga

DBGET integrated database retrieval system