KEGG   Aeromicrobium erythreum: AERYTH_11480Help
Entry
AERYTH_11480      CDS       T04236                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
aer  Aeromicrobium erythreum
Pathway
aer00010  Glycolysis / Gluconeogenesis
aer00053  Ascorbate and aldarate metabolism
aer00071  Fatty acid degradation
aer00280  Valine, leucine and isoleucine degradation
aer00310  Lysine degradation
aer00330  Arginine and proline metabolism
aer00340  Histidine metabolism
aer00380  Tryptophan metabolism
aer00410  beta-Alanine metabolism
aer00561  Glycerolipid metabolism
aer00620  Pyruvate metabolism
aer00625  Chloroalkane and chloroalkene degradation
aer00903  Limonene and pinene degradation
aer01100  Metabolic pathways
aer01110  Biosynthesis of secondary metabolites
aer01120  Microbial metabolism in diverse environments
aer01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AERYTH_11480
   00053 Ascorbate and aldarate metabolism
    AERYTH_11480
   00620 Pyruvate metabolism
    AERYTH_11480
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AERYTH_11480
   00561 Glycerolipid metabolism
    AERYTH_11480
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AERYTH_11480
   00310 Lysine degradation
    AERYTH_11480
   00330 Arginine and proline metabolism
    AERYTH_11480
   00340 Histidine metabolism
    AERYTH_11480
   00380 Tryptophan metabolism
    AERYTH_11480
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AERYTH_11480
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AERYTH_11480
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AERYTH_11480
Enzymes [BR:aer01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AERYTH_11480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALX05276
UniProt: A0A0U4CRQ8
Position
complement(2423800..2425332)
Genome map
AA seq 510 aa AA seqDB search
MSDVTTRALEILQRLGAGNPFDAVPEGAQRDLPATSPIDGHEIGRLASHSAADVGDAVGR
AHDAFLQWRSVPAPVRGQFVRELGELLREHKDDLGALVSIEAGKILSEGLGEVQEMIDIC
DLAVGLSRQLHGLTIATERPGHRMMEQWHPLGVVGVISAFNFPVAVWSWNAALAFVCGDA
VVWKPSEKTMLTALACQALADEAARRAGAPEHLSQVVLGAREVGEALVDDPRVPLVSATG
STRMGKEVAPRVAARLGRSLLELGGNNAAVVAPSADLDLAVRGIVFSAVGTAGQRCTSLR
RVIVHESIKDELVERLAKAYATLPIGSPLDPTTLVGPLVDEASFRAFGDAISRAQADGGT
LVTGGAQDVAASDATGGGYYVQPAIVDMPGQTDVVKEETFAPILYVLTYSSFVDALALHN
DVAQGLSSSIFTLDVREAETFVSAVGSDCGIANVNIGPSGAEIGGAFGGEKDTGGGRESG
SDAWRAYMRRATNTVNYSTELPLAQGVEFV
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgtcaccacccgcgccctcgagatcctgcagcgcctcggcgccggcaatccc
ttcgacgccgttcccgagggggcgcagcgcgacctgcccgcgacgtcgccgatcgacggc
cacgagatcggtcggctcgcgtcgcactcggccgccgacgtcggcgacgcggtgggccgc
gcgcacgacgccttcctgcagtggcgcagcgtcccggcgccggtgcgcggccagttcgtg
cgcgagctgggcgagctgctccgcgagcacaaggacgacctcggcgcgctggtgagcatc
gaggccgggaagatcctgagcgagggtctgggtgaggtgcaggagatgatcgacatctgc
gacctcgcggtcgggctctcccgccagctgcacgggctgacgatcgccaccgagcgtcct
gggcaccggatgatggagcagtggcacccgctgggcgtcgtcggcgtcatcagcgccttc
aacttcccggtcgcggtgtggtcgtggaacgcggcgctcgcgttcgtctgcggcgacgcc
gtggtgtggaagccgtcggagaagacgatgctgaccgccctcgcatgccaggccctcgcc
gacgaggcggcccgccgcgccggcgcgccggagcacctgtcgcaggtcgtgctcggcgcc
cgtgaggtcggcgaggcgctcgtcgacgacccgcgcgtgccgctcgtctcggccaccggc
tccacccggatgggcaaggaggtcgcgccgcgcgtggccgcccgcctgggccgctcgctg
ctcgagctcggcggcaacaacgccgccgtcgtggcgcccagcgccgacctcgacctcgcc
gtgcgcggcatcgtgttctccgccgtcggcacggccggccagcgctgcacgtcgctgcgt
cgcgtgatcgtgcacgagagcatcaaggacgagctggtggagcggctggcgaaggcgtac
gcgacgctgccgatcggctcgccgctggatccgaccacgctcgtcgggcccctggtcgac
gaggcgtcgttccgggcgttcggcgacgcgatcagccgtgcccaggccgacggcggcacg
ctcgtcaccggcggcgcgcaggacgtcgccgccagcgacgcgaccggcggcggctactac
gtgcagcccgccatcgtcgacatgcccggccagaccgacgtcgtgaaggaggagacgttc
gcgccgatcctctacgtgctcacctactcctcgttcgtcgatgccctggccctgcacaac
gacgtcgcccagggcctgtcgtcctcgatcttcaccctcgacgtgcgcgaggccgagacg
ttcgtgtcggcggtcggctccgactgcggcatcgccaacgtcaacatcggcccctcgggt
gccgagatcggtggcgcgttcggcggggagaaggacaccggcggcggtcgcgagtcgggc
tccgacgcgtggcgcgcctacatgcgccgcgcgacgaacacggtgaactactccaccgag
ctgccgctggctcagggcgtggagttcgtgtga

DBGET integrated database retrieval system