KEGG   Aeromicrobium erythreum: AERYTH_14365Help
Entry
AERYTH_14365      CDS       T04236                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
aer  Aeromicrobium erythreum
Brite
KEGG Orthology (KO) [BR:aer00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AERYTH_14365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ALX05793
UniProt: A0A0U4BKZ1
Position
complement(3008503..3009528)
Genome map
AA seq 341 aa AA seqDB search
MDLVLAMVIAVVVIALVFDYTNGFHDAANAIATSISTRALTPRIALAMAAVLNFVGALLG
VGVAQTIQGIIDIDSQVSSGVSIDRAHGLTIVLAALVGAITWNLITWYFGIPSSSSHALI
GGIVGAGAASSTTVDWGTLVEKVAIPMVASPLIGFVGAFALMTAIMWIFRRANPGKVSRG
FRHAQTVSAAGMSLGHGLQDAQKTMGVIVLALVAGGFEDGSDVPLWVIVAAASAIAAGTY
SGGWRIMRTLGRRIIDLDPPRGFAAEGVAATVLYVMAIGLHAPVSTTHTITSAIMGSGAT
KRFSAVRWGVAKGIVTAWIVTIPAAAAVAAVFYFIARLFLP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggacctcgtcctggcgatggtgatcgccgtcgtcgtcatcgcgctcgtcttcgactac
acgaacgggttccacgacgccgccaacgcgatcgccacctcgatctccacgcgcgccctc
acaccgcgcatcgcgctggccatggccgccgtcctcaacttcgtcggcgcgctgctcggc
gtcggcgtcgcgcagaccatccaaggcatcatcgacatcgactcccaggtgtcgtcgggt
gtgtccatcgaccgcgcccacggcctgacgatcgtgctcgccgcgctcgtcggcgccatc
acctggaacctcatcacctggtacttcggcatcccgtcgtcgtcgtcgcacgccctcatc
ggaggcatcgtcggtgccggtgcggcgtcgtcgacgaccgtcgactggggcacgctggtg
gagaaggtcgccatcccgatggtcgcctcgccgctcatcggcttcgtcggggcgttcgcc
ctgatgaccgccatcatgtggatcttccgtcgagccaaccccggcaaggtcagccgcggg
ttccggcacgcgcagaccgtctccgccgccggcatgtcgctcggccacggcctgcaggac
gcgcagaagacgatgggcgtcatcgtcctcgccctggtcgccggcgggttcgaggacgga
tcggacgttcccctgtgggtcatcgtcgccgccgcctccgccatcgcggccggcacctac
tccggcggctggcgcatcatgcgcaccctcggccgacgcatcatcgacctcgacccgccc
cgcgggttcgccgccgagggcgtggccgcgaccgtcctgtacgtcatggccatcggcctg
cacgcccccgtctcgaccacccacacgatcacctcggcgatcatgggctccggcgccacc
aagcggttcagcgccgtccggtggggcgtggccaagggcattgtgaccgcctggatcgtc
accatcccggccgccgcagccgtggcggcggtgttctacttcatcgcccggctcttcctg
ccttag

DBGET integrated database retrieval system