KEGG   Aeromonas sp. ASNIH5: C2U30_04535Help
Entry
C2U30_04535       CDS       T05873                                 

Definition
(GenBank) acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
aes  Aeromonas sp. ASNIH5
Brite
KEGG Orthology (KO) [BR:aes00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C2U30_04535
Enzymes [BR:aes01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     C2U30_04535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AUT44231
UniProt: A0A2I8DAU1
Position
1021523..1022338
Genome map
AA seq 271 aa AA seqDB search
MDSLRVAVLQMVSGDDLDHNLTQAEALLRQAAAEGAELALLPEYFYLMPVDERARVALAA
PAGDHPLLAWVQRLARELGVWILAGTLPLASHEPGKMHNSSLLIDPQGQLASRYDKLHLF
GFCTGQEQYDEAATMTPGREVVSHPLPWGVLHLGICYDLRFPELFRLGPAPDFIALPAAF
THTTGLAHWALLLRARAVENLAFVFASAQGGHHPGGRRTFGHSMIIDPWGRILAQVEEGQ
GMAIATLDLAAQRTVRCQLPALTHRKIAVGP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggattcactgcgcgttgccgtcctccagatggtctccggggatgaccttgaccacaac
ctgacccaggccgaggcgctgctgcgtcaggccgcggccgagggggcagaactggccctg
ctgcccgaatacttctacctgatgccggttgatgagcgggcgcgggtggccctggccgcc
cccgctggcgatcaccccctgctggcctgggtacagaggctggcccgggagctcggcgtc
tggatcctggccggcacattgccgcttgccagccacgagcccggcaagatgcacaacagc
agcctgctcatcgacccccaagggcagctcgcaagccgctacgacaagctgcacctgttt
ggcttttgcaccgggcaagagcagtatgacgaggccgcgaccatgaccccgggccgggag
gtggtgagccatcccctgccctggggcgtgctgcacctcgggatctgctacgacctgcgc
ttcccggagctgtttcgcctggggcccgcccccgatttcatcgccctgcccgcggccttc
acccacaccaccgggctcgcgcactgggcgctgctgctgcgggcacgtgcggtagagaac
ctggccttcgtgttcgccagtgcccaggggggacaccaccccggtgggcggcgcaccttc
ggccacagcatgatcatcgatccctggggccggatactggcccaggtagaggagggtcag
ggcatggccatcgccaccctggatctggcggcacagcgcacggtgcgctgccagttgccg
gccctcacccatcgcaagatagccgtcggcccttga

DBGET integrated database retrieval system