KEGG   Aeromonas sp. ASNIH5: C2U30_13910Help
Entry
C2U30_13910       CDS       T05873                                 

Definition
(GenBank) valine--pyruvate transaminase
  KO
K00835  valine--pyruvate aminotransferase [EC:2.6.1.66]
Organism
aes  Aeromonas sp. ASNIH5
Pathway
aes00290  Valine, leucine and isoleucine biosynthesis
aes01100  Metabolic pathways
aes01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aes00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    C2U30_13910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aes01007]
    C2U30_13910
Enzymes [BR:aes01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.66  valine---pyruvate transaminase
     C2U30_13910
Amino acid related enzymes [BR:aes01007]
 Aminotransferase (transaminase)
  Class I
   C2U30_13910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AUT42680
UniProt: A0A2I8D5W6
Position
2988836..2990086
Genome map
AA seq 416 aa AA seqDB search
MEFSLFGEKFTRHAGITQLMDDLNQGLLNPDAIMLGGGNPAPIPAMLERFQAEANTLLDN
GELIKAMANYDGPQGKDRFTRALAALLSKELGWEISARNIALTNGSQNAFFYLFNLLAGE
FADGRKKKVLFPLAPEYIGYADSALSDDHFVAYKPTIEKLPDGQFKYHVDFESLQVGDDI
GVICVSRPTNPTGNVLTDEEIEHLDQIARDKGIPLLIDNAYGVPFPGIIFSDAKPFWNAN
TILCMSLSKLGLPGTRCGIVIADEKIIRAITNLSGIINLAPGSLGPAITIPMIESGDIIT
LSEQVVKPFYQQKATFAVQLLREAIPDPRFHIHKPEGALFLWLWFEDLPIHCQELYERLK
AKNLLIVPGHYFFPGIDDPEWRHSQECIRLNYAQSEDLVRRGIAILADEINALYTG
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaattctccttgttcggcgagaagttcactcgccacgccggtattacccaactcatg
gacgacctcaatcaagggctgctgaatcccgacgccatcatgctgggaggcggcaatccg
gcccccatccccgccatgctggaacgctttcaggccgaggccaataccctgctcgacaac
ggcgaactgatcaaggccatggccaactacgatggcccccagggcaaggacaggttcacc
agggcgctggccgccctgctcagcaaggagctgggctgggagatctccgcccgcaacatc
gccctgaccaacggcagccagaacgccttcttctatctgttcaacctgctggccggcgag
ttcgccgacggtcgcaagaagaaggtgctgttccccctggcccccgaatacatcggctat
gccgactcggccctctcggacgatcatttcgtcgcctacaagcccaccatcgagaagctg
cccgacggccagttcaaataccacgtggatttcgagagcctgcaggtgggcgacgacatc
ggggtgatctgtgtctcccggccgaccaaccccaccggcaacgtgctcaccgacgaggag
atcgagcacctcgatcagatcgcccgtgacaaggggatcccgctgctcatcgacaatgcc
tacggagtccccttccccggcatcatcttcagcgacgccaagccgttctggaacgccaac
accatcctctgtatgagcctctccaagctcggcctgccgggcacccgttgcggcatcgtc
atcgccgacgagaagatcatccgggccatcaccaacctgagcggcatcatcaatctggcg
ccgggcagcctgggtccggccatcaccattccgatgatcgagagcggtgacatcatcacc
ctgagcgagcaggtggtgaaacccttctaccagcagaaagccaccttcgcggtccagctg
ctgcgcgaggccattccggatccgcgcttccacatccacaagccggagggagccctcttc
ctctggctctggttcgaagacctgccgatccactgccaggagctgtatgagcgactgaag
gcgaagaacctgctgatcgtgcccggccactacttcttccccggcatcgacgaccccgag
tggcgccacagccaggagtgcatccgcctcaactatgcccagagcgaagatctggtgcgt
cgtggcatcgccatcctggccgacgagatcaacgccctctacaccggttga

DBGET integrated database retrieval system