KEGG   Aeromonas sp. ASNIH5: C2U30_15850Help
Entry
C2U30_15850       CDS       T05873                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
aes  Aeromonas sp. ASNIH5
Pathway
aes03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aes00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    C2U30_15850
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aes03011]
    C2U30_15850
Ribosome [BR:aes03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    C2U30_15850
  Bacteria
    C2U30_15850
  Archaea
    C2U30_15850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AUT43003
UniProt: A0A2I8D6R6
Position
3385221..3385565
Genome map
AA seq 114 aa AA seqDB search
MEAIAKHRYARTSAQKARLVADQVRGLSVDKALNILTFSPKKAAVLVKKVLESAIANAEH
NEGADIDTLRVATIMVDEGPSMKRIRPRAKGRADRILKRTAHITVVVSDAKAGR
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggaagctatcgctaaacaccgttatgcccgtacttctgcccagaaagctcgtctggta
gccgatcaagtacgtggtctgtccgtagacaaggctctgaacatcctgaccttcagcccg
aaaaaggctgctgttctggtgaagaaagtgctggaatctgccattgccaacgctgagcac
aacgaaggtgccgatatcgacaccctgcgtgttgccaccatcatggtagacgaaggtccc
tccatgaagcgcatccgcccgcgtgccaaaggtcgcgcggatcgtatcctcaagcgtacc
gctcacatcactgtagtggtatccgacgctaaggctgggagataa

DBGET integrated database retrieval system