KEGG   Actinobacillus equuli: ACEE_03455Help
Entry
ACEE_03455        CDS       T03501                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
aeu  Actinobacillus equuli
Brite
KEGG Orthology (KO) [BR:aeu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ACEE_03455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AIZ78844
UniProt: A0A0A7ME98
Position
complement(720655..721917)
Genome map
AA seq 420 aa AA seqDB search
MELLQEYGSTLVIITALFGFFMAFGIGANDVSNAMGTSVGSGTITARQAIMIAMVFEFAG
AYLAGGEVTETIKSGIIDVSLFADKPDILVLGMMSALFAAGFWLLIASKMGWPVSTTHAI
IGAIIGFGCLTVGSDAVQWGQLGGIVGSWFITPVIAGIVAYWIFTSTQKLIFDTAEPMKN
AQKYGPFYMALTAFILSIVTMTKGLKHVGLHLTTTETVVISSAIAAVAVIACYFYFRSEA
FAKRAQGAAFGGVEKVFSILMLLTACSMAFAHGSNDVANAVGPLSAVVSIVESGGMVSGK
AALAPWILPLGAAGIAAGMLIMGYKVMGTMGTGITDLTPSRGFSAEFACATTVVIASGTG
LPISTTQTIVGAILGVGFARGIAALNLGIIRNIVASWVITLPAGAIIAIVIYEILLAIFY
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaattgcttcaagaatatggctctacgttagtcattattactgccctttttggtttt
tttatggcatttggtatcggtgccaacgacgtatctaatgcaatgggtacatcggtaggt
tcaggtacgatcactgcacgccaagcaattatgattgcaatggtatttgaatttgcaggt
gcttatcttgcaggtggtgaagtaaccgaaacgattaaaagcggtattattgacgtttca
ctttttgctgataagcctgatattttagtattaggaatgatgtctgcgctttttgctgcc
ggtttttggttattaatcgcatcaaaaatgggctggcctgtttcaacaacgcatgccatc
atcggtgcaatcatcggttttggttgtttaaccgtaggtagtgatgcagtacagtgggga
caattaggcggcatcgtaggtagctggtttatcacaccggttattgctggtatcgtagct
tactggatttttaccagtacacaaaaattgatcttcgatacggcagagccgatgaaaaat
gcacaaaaatacggtcctttttatatggcactaactgcttttattttaagtatcgttacg
atgactaaaggtttgaaacacgtaggtctacatttaaccacaactgagaccgtggtaatt
tcttcagcaattgcggctgtcgctgttattgcttgttatttctacttccgcagtgaagca
tttgcaaaacgtgctcaaggtgcagcgtttggcggtgtggaaaaagtatttagtatctta
atgctattaacagcctgttcaatggcattcgcgcatggttcgaatgacgttgcaaacgct
gtaggtcctctttcagcggtggtatcaatcgtagaaagtggcggtatggtgagtggtaaa
gcggcattggcgccgtggatcttacctttaggtgctgcaggtattgctgctggtatgctt
attatgggctacaaagtaatgggcacaatgggtaccggtattactgacttaacaccaagc
cgtggcttctctgctgaattcgcttgtgcgaccactgtggttatcgcttctggcaccggt
ttaccgatttcaacaacgcaaaccatcgttggtgcaattttaggtgtgggctttgctcgc
ggtattgcagcattaaacttaggtattattcgtaatatcgttgcttcgtgggtaattaca
ttacctgcaggcgcaattatcgctattgttatttatgaaattctattagcgattttctac
taa

DBGET integrated database retrieval system