KEGG   Actinobacillus equuli: ACEE_03605Help
Entry
ACEE_03605        CDS       T03501                                 

Definition
(GenBank) ribosomal RNA large subunit methyltransferase M
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
aeu  Actinobacillus equuli
Brite
KEGG Orthology (KO) [BR:aeu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:aeu03009]
    ACEE_03605
Enzymes [BR:aeu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     ACEE_03605
Ribosome biogenesis [BR:aeu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ACEE_03605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN
Motif
Other DBs
NCBI-ProteinID: AIZ78873
UniProt: A0A0A7MEL6
Position
753535..754626
Genome map
AA seq 363 aa AA seqDB search
MNKLALYCRAGFEKETAGEITDKAAQFGVFGFVNLKENSGYIIFECYQAGDADRLARELK
FEQLIFARQMIVVGDMLQALPVEDRISPILAQYQALNPRHSSDIFVETPDTNEAKELLTF
CRKFTVPLRNSLKKQGWLTKSERAKGSISLHILFVRPGCCYVGYAYNDNKSPFFMGIPRL
KFPAEAPSRSTLKLEEAILTFIPEAEEKKRFTDEMTGVDLGACPGGWTYQLVKRGVFVYA
VDHGKMAASLHETGRIEHCPEDGFKFQPPKRKTIDWLVCDMVEQPMRISKLIGKWLINGW
CRETIFNLKLPMKKRYQEVQLCLAYLEEELEKQGFWFKIQAKHLYHDREEITVHIAVMGR
KPQ
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacttgcattatattgccgagcgggcttcgaaaaagaaaccgccggggagatt
accgataaagcggcacaatttggtgtgttcggctttgtgaatttaaaagaaaatagtggt
tatattatttttgaatgttatcaagcaggtgatgcggatcgcttagcaagagaattaaaa
ttcgaacaattgatttttgctcgtcaaatgattgtagtcggcgatatgttacaagctctg
cctgtcgaagatcgcatttcaccaattttggctcaataccaagcgttaaatcctcgtcat
agttcggatatttttgttgaaacgccggatactaacgaagcaaaagaattactgaccttt
tgccgtaaattcaccgtgccgttacgtaatagtttgaaaaaacaaggttggctaactaag
tctgaacgtgcaaagggtagtatcagcttacatattttgtttgtccgtccgggttgttgc
tatgttggttatgcctataatgataataaatcgccgttttttatgggaattccccgtttg
aaattcccggcggaagccccaagccgttcgaccttaaaattagaagaagcgatcctcact
tttattccggaagcggaagagaaaaaacgttttaccgatgaaatgaccggtgtggattta
ggggcttgcccgggcggttggacctatcaactagttaaacgtggcgtattcgtgtatgcg
gtggatcacggcaaaatggcggcaagcctacatgaaaccggacgcattgagcattgccct
gaagacggttttaaattccaaccgcctaaacgtaaaacgattgactggttggtgtgtgat
atggtggaacagccaatgcggataagcaaattaatcggtaaatggttaattaacggttgg
tgtcgagaaacgattttcaacttaaaattgccgatgaaaaaacgttatcaagaagtgcaa
ttatgtttagcgtatcttgaagaagaactcgaaaaacaaggtttttggtttaaaattcaa
gcgaaacatctttatcacgatagagaagaaattaccgtacatattgcggtcatgggacgt
aaaccccaataa

DBGET integrated database retrieval system