KEGG   Actinobacillus equuli: ACEE_05255Help
Entry
ACEE_05255        CDS       T03501                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
aeu  Actinobacillus equuli
Brite
KEGG Orthology (KO) [BR:aeu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aeu03016]
    ACEE_05255
Enzymes [BR:aeu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     ACEE_05255
Transfer RNA biogenesis [BR:aeu03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    ACEE_05255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AIZ79188
UniProt: A0A0A7MFE7
Position
1130784..1131536
Genome map
AA seq 250 aa AA seqDB search
MELEILYRDDELIAINKPAGMLVHRSWLDKHETQFAMQTLRDQIGQHVFPIHRLDRPTSG
VLLFALNSEMARLMSEQFEQHQMEKGYLAVVRGYLLDKGEIDYPLKVILDKIADKFSQPK
EAQQAVTFYQNLASVEMPYPAGKHQTARYSLVELLPKTGRKHQLRRHMKHLFHPIMGDTK
YGDLHQNRTLTEKTGCDRLMLHSHFLKFTHPKTAQKIEIFAPLDEQWQNLFITFNWNFPI
FFQSDKSKYG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgaaattttataccgtgatgatgaactgattgcaatcaacaaaccggctgga
atgttagtccaccgctcatggctggataaacatgaaacgcaatttgcgatgcaaacctta
cgtgatcaaatcggtcagcacgtcttccccattcatcgcttagatcgacctacttccggc
gtgttattgtttgcattaaatagtgaaatggctcgcctgatgagtgaacaatttgaacaa
catcaaatggagaaaggctatttagcagtggtacgaggctatctgcttgataaaggcgag
atcgattatccgctaaaagtgattttagacaaaattgccgataagttttcgcaaccgaaa
gaagcccaacaagcggtcactttttaccaaaatcttgcaagtgtcgaaatgccctatccg
gcaggcaaacatcaaaccgcacgttacagtttggttgaattattaccgaaaaccggacgc
aaacaccaattgcgccgccatatgaaacatctatttcatccgattatgggcgatactaaa
tatggtgacttgcaccaaaatcgtaccctaaccgagaaaaccggttgcgaccgattaatg
ctacattcacattttttgaaatttacgcatccgaaaacagcgcaaaaaatcgaaattttt
gcaccgcttgatgaacaatggcaaaatttatttattacgtttaactggaacttcccaatt
ttttttcaatctgataagagcaaatatggataa

DBGET integrated database retrieval system