KEGG   Actinobacillus equuli: ACEE_08270Help
Entry
ACEE_08270        CDS       T03501                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aeu  Actinobacillus equuli
Pathway
aeu00071  Fatty acid degradation
aeu00072  Synthesis and degradation of ketone bodies
aeu00280  Valine, leucine and isoleucine degradation
aeu00310  Lysine degradation
aeu00362  Benzoate degradation
aeu00380  Tryptophan metabolism
aeu00620  Pyruvate metabolism
aeu00630  Glyoxylate and dicarboxylate metabolism
aeu00640  Propanoate metabolism
aeu00650  Butanoate metabolism
aeu00900  Terpenoid backbone biosynthesis
aeu01100  Metabolic pathways
aeu01110  Biosynthesis of secondary metabolites
aeu01120  Microbial metabolism in diverse environments
aeu01130  Biosynthesis of antibiotics
aeu01200  Carbon metabolism
aeu01212  Fatty acid metabolism
aeu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACEE_08270
   00630 Glyoxylate and dicarboxylate metabolism
    ACEE_08270
   00640 Propanoate metabolism
    ACEE_08270
   00650 Butanoate metabolism
    ACEE_08270
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ACEE_08270
   00072 Synthesis and degradation of ketone bodies
    ACEE_08270
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACEE_08270
   00310 Lysine degradation
    ACEE_08270
   00380 Tryptophan metabolism
    ACEE_08270
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ACEE_08270
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACEE_08270
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACEE_08270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aeu04147]
    ACEE_08270
Enzymes [BR:aeu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ACEE_08270
Exosome [BR:aeu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACEE_08270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIZ79762
UniProt: A0A0A7MJ07
Position
complement(1769607..1770788)
Genome map
AA seq 393 aa AA seqDB search
MKNVVIASAVRSAIGNFGGSLANVSAVELGSIVIKNAIEKAGIDITTVDEVIMGNVLQAG
LGQNPARQAALKSGISEDVSAYTVNKVCGSGLKSVALAVQAILAGDAKIIIAGGMENMSQ
APYLLDSKARWGYRLGDNKVQDVILKDGLICAEHHYHMGITAENVAEKYAITREQQDELA
LASQQKAVSAIEAGAFKNEIVPVTVKVKKKEFVFDTDEFPKKDCSLEGLAALRPAFDKEG
SVTAGNASGINDGAAALVIVEEETAKALGLPILARVKGYASGGVAPEIMGMGPVPATRKV
LEKTGLSLDDIDLIEANEAFAAQFLAVGKELNFDPEKVNVNGGAIALGHPIGASGARILV
SLVHALHARDKKLGLATLCIGGGQGIAMIVERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgttgttattgcaagtgctgtacgttcagctattggtaactttggtggctct
ttagcaaatgtaagtgcagtcgaattaggttcaatagtcataaaaaatgcgattgaaaag
gcagggattgatattaccactgttgatgaagttattatggggaatgtattacaggcgggt
ttaggacaaaaccctgctcgtcaagctgcattaaaaagtggcattagcgaggacgttagt
gcatatacagtaaataaagtgtgcggctcaggtttaaaaagtgtggcattagcagtacaa
gctattttggctggggatgcaaagattattattgccggtggtatggaaaatatgagccaa
gccccgtatttattagatagtaaagcacgttggggttatcgcttgggtgataataaagtg
caagatgtcattttaaaagatggattgatttgtgccgaacatcactaccacatgggcatt
actgctgaaaatgtggcggaaaaatatgccattacccgtgaacaacaagatgaattagca
ttggcttctcaacaaaaagcggtttcagcaattgaagcgggtgcgtttaaaaatgaaatt
gtgccggttacagtaaaagtgaagaaaaaagagtttgtctttgataccgatgaatttcca
aaaaaagattgttctttagaaggattggcggctttacgtccagcatttgataaagaaggt
tcagttactgcgggtaatgcatcagggatcaatgatggtgctgctgcacttgttattgta
gaagaggaaacagcaaaagcattgggcttaccaatccttgctcgtgtaaaaggctatgcc
agcggtggtgttgcgcctgaaattatgggaatgggacctgttccggcaacgcgaaaagta
ttggaaaaaacagggctgagcttagatgatattgatttaattgaagcaaatgaagcattt
gcggctcaattccttgcagtaggaaaagaactgaattttgatccggaaaaggtgaatgtt
aacggtggtgcaattgcgcttggtcacccgattggcgcgagtggtgcaagaattttagta
agtttggttcatgcacttcatgctagagataaaaaactaggacttgcaacattatgtatt
ggtggcggtcaagggattgccatgattgttgaacgtgtttaa

DBGET integrated database retrieval system