KEGG   Actinobacillus equuli: ACEE_11090Help
Entry
ACEE_11090        CDS       T03501                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
aeu  Actinobacillus equuli
Pathway
aeu00620  Pyruvate metabolism
aeu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACEE_11090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aeu02000]
    ACEE_11090
Enzymes [BR:aeu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     ACEE_11090
Transporters [BR:aeu02000]
 Other transporters
  Primary active transporters [TC:3]
   ACEE_11090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Amidohydro_1 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AIZ80286
UniProt: A0A0A7MNJ5
Position
complement(2340340..2342145)
Genome map
AA seq 601 aa AA seqDB search
MTIQNKKIAITDVVLRDAHQSLFATRLRLDDMLPIAAELDKIGYWSLEAWGGATFDSCIR
FLGEDPWVRLRELKKAIPNTPLQMLLRGQNLLGYRHYADDVVDRFVERCVTNGMDVFRVF
DALNDPRNMQAALQAVKKHGGHAQGTLSYTTSPVHTLQTWLDVTEQLLEIGVDSLVIKDM
SGILTPMAAYELVSEIKKRYDVELHLHCHSTTGMAEMALLKAIEAGVDGVDTSISSMSGT
YGHPATESIVATLQGTPYDTGLNIPQLEKISAYFRDVRKKYAKFEGQLRGVDSRILVAQV
PGGMLTNLESQLKQQNASDKLDLVLQEIPRVREDLGNIPLVTPTSQIVGTQAVMNVLMGE
RYKTIAKETAGILKGEYGRTPAPVNKALQERVLEGAAPITDRPANHIAPEIDKLVAEVTA
QAKEKSITLSENTIDDVLIVALFQQVGWKFLENRNNPAAFEPAPTAEVAKEAAKPTASHT
AKAGEPAVYTVELEGKAFVVKVSEGGDITNIAPTAPTAALQVAAPAATSANAEPVKAPMA
GNILKVEVSEGQQVAEGDVLLILEAMKMETQICAPKAGKVQGIAAKQGDVVAVDQVLMNL
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgactattcaaaacaaaaaaattgcgattactgatgttgttttacgtgatgcacaccaa
tctttgtttgcgacacgactacgtttagacgatatgttaccgattgcggctgaattagat
aaaatcggctattggtctttagaagcatggggcggtgcgacttttgatagctgtatccgt
tttttaggtgaagatccttgggtacgtttgcgtgagttgaaaaaagcgattccaaataca
ccactgcaaatgttattacgcggacaaaatttattaggctaccgtcattatgcggatgat
gtggtagatcgctttgtggaacgttgtgttaccaatgggatggatgtgttccgtgtgttt
gatgcgttaaatgaccctcgcaatatgcaagcggcactacaagcggtcaaaaaacacggt
gggcatgcacaaggtacgttaagttataccaccagtccggtacacacgttacaaacgtgg
ttagacgtaaccgaacaattattggaaatcggggtagactctctcgttatcaaagatatg
tcaggtatcttaaccccaatggctgcgtacgagttagtcagtgaaattaaaaaacgttat
gacgtagaacttcacttacactgccactcaaccaccggtatggcggaaatggcattatta
aaagcgattgaagcgggtgttgatggtgtagatacctctatttcttcaatgtccggcact
tatggtcatccggcaaccgaatctattgtcgcaacacttcaaggcacgccttacgacacc
ggcttgaacattcctcaacttgaaaaaatctcagcttacttccgtgacgttcgtaaaaaa
tatgcgaagtttgaagggcaattacgtggtgtagacagccgtattttagttgcacaagtg
ccgggcggtatgttaaccaaccttgaaagccagttaaaacaacaaaatgcaagtgacaaa
cttgatcttgtattacaagaaatccctcgcgtacgtgaagatctcggtaatattccgctt
gttacgccaacatctcaaatcgtcggcacccaagcagtaatgaacgtgttaatgggcgag
cgctacaaaaccatcgccaaagaaaccgccggtattttaaaaggcgaatacggtcgcaca
cctgcaccagtcaataaagcgttacaagaacgtgtgcttgaaggtgctgcaccgattacc
gatcgtccggcaaaccatatcgcaccggaaatcgataaattagtggcggaagtaactgca
caggctaaagagaaaagtattactctttcagaaaatacgattgatgacgtgttaatcgtg
gcgttattccaacaagtcggttggaaattcttagaaaaccgtaataatccggcagcattc
gaaccggctccgaccgcagaagttgcaaaagaagcggcaaaaccgaccgcttctcacaca
gcaaaagcaggtgaaccagccgtttatacggttgaacttgaaggcaaagcctttgtagtg
aaagtcagtgaaggtggtgatattacaaatattgcaccgacagcaccaaccgcagcacta
caagttgcagctcctgcagcaaccagtgcaaatgctgaaccagtcaaagcaccgatggca
ggtaacattcttaaagttgaagttagcgaaggtcagcaagttgcagaaggcgatgtgtta
ttaattcttgaagcaatgaaaatggaaactcaaatttgcgcaccaaaagccggtaaagtc
caaggcattgcggcaaaacaaggtgatgtcgttgcagttgatcaagtattaatgaatctt
gcttaa

DBGET integrated database retrieval system