KEGG   Aequorivita sp. H23M31: EI546_04200Help
Entry
EI546_04200       CDS       T05794                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
aev  Aequorivita sp. H23M31
Brite
KEGG Orthology (KO) [BR:aev00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aev01002]
    EI546_04200
Enzymes [BR:aev01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     EI546_04200
Peptidases [BR:aev01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   EI546_04200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-ProteinID: QAA80977
UniProt: A0A410G138
Position
complement(931962..934001)
Genome map
AA seq 679 aa AA seqDB search
MKNIFFIALTLCGLLFFSCKENKEEKEVAQVETVQPANYDSAEEQFGDVRILHYQIPGWD
KLTLKEQKLVYYLGQAGLEGRDIMWDQNYRHNLAIRKALENVFQNYQGDKTSEDWKNFEI
YLKRVWFSNGIHHHYSNDKLKPGFSSDYLKQLLMDTNTTLEGEAFEVIFNDKDMKKVNLS
KGLDNVANSAVNFYGPEITNKDVETFYSKKKSPDPTKPLSFGLNSKLVKENGEVKELIYK
SGGLYGAAIDKIIGWLEKAQGVAENEAQGNAIGLLIKYYKTGDLQTWDDYNVAWTGATEG
NIDYINSFIEVYNDPLGYKGSYETIVQIKDFDMSEKMAVLSENAQWFEDNSPLMEEHKKK
NVVGVSYKVVNVAAEAGDASPSTPIGVNLPNADWIRAAVGSKSVSLGNIIDAYNNSGSSG
RLHEFVNDSTELELEEKYGQLADKLHTALHEVIGHASGQMNPGVGETKETLKNYASTLEE
GRADLVGLYYLYTPKLQELGLVDDWKKVGMAAYDGYIRNGLMTQLIRLDLGDDIEESHMR
NRQWVSAWVFEKGKKDNVIEKITRDGKTYFNITDYEKLHELFGQLLRETQRIKSEGDYKA
VEHLVETYGVKVDPALHKEVLERNKQFTAAPYSGFVNPVLVPKMNDKGEIESIGVEQPKS
FEEQMLFYSKNYNNLPEVN
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacatcttttttattgccctaacattgtgcggattactgtttttttcttgtaag
gaaaacaaggaggaaaaggaagtggcacaagttgaaacagtgcaacctgccaactatgat
tctgctgaagaacagttcggtgacgttcgtattctgcattatcaaattcccggatgggac
aaacttaccctaaaggaacaaaaactggtttattacctaggtcaggcaggtcttgaaggt
agagatattatgtgggaccagaattatcgccacaaccttgccattagaaaggctcttgaa
aatgtatttcaaaattaccaaggtgataaaacatctgaagattggaaaaactttgaaata
tatcttaaaagagtatggtttagcaatgggatacaccatcactattcaaatgacaagtta
aagcctggattttcttcagattacctcaagcaactcttgatggatacgaacacaaccttg
gagggagaagcttttgaagtgatattcaacgataaggatatgaaaaaagtaaacttgagc
aagggtcttgacaacgttgccaatagtgcggtaaacttttatggtccagaaataaccaat
aaggatgtagaaactttctattccaaaaagaaatcgccagatcccactaaacctctttct
ttcggtctaaactcaaaactggtaaaagagaatggtgaggttaaggaattgatctacaaa
tctggcggactttacggagcggcaatagataaaataatcggttggttagaaaaagctcaa
ggagtagccgaaaatgaggcgcaaggaaatgcaattggtttattgatcaagtattataaa
actggcgatcttcaaacttgggatgattataacgtagcttggaccggcgccactgaaggc
aatattgattatataaacagttttattgaagtttacaatgatcctctgggttataaaggt
tcttatgaaaccatcgttcagattaaggattttgatatgtctgaaaaaatggcagtactt
tctgaaaacgcacaatggtttgaggacaattcgccattgatggaagagcacaaaaagaaa
aatgttgttggggtaagttacaaagtagtaaatgtagctgccgaagccggagatgcttca
ccgagcacacctattggggttaatcttccaaatgcggattggattcgtgcagctgtaggt
agtaagtcggtttctcttggtaatattatagacgcttataacaactccggaagttctgga
aggttgcatgagtttgtaaatgattctaccgagttggaattggaagaaaaatacgggcaa
cttgccgataaactccatacagcgcttcatgaggttattggtcacgcttccggtcaaatg
aatcctggggttggagaaactaaagaaactttgaagaattatgcttcaactctggaagaa
ggccgtgctgaccttgtaggtctttactacctatacactccaaaacttcaagaactcggt
ttggtggatgattggaaaaaggtgggaatggcagcctatgacggatatattagaaatggt
ctgatgacgcaattgatccgccttgacctaggagatgatattgaggaatcgcatatgcgc
aaccgtcagtgggtttctgcttgggtgtttgaaaaaggcaaaaaagacaatgtgatcgaa
aagataacccgtgacggaaaaacctatttcaacattactgattatgaaaaacttcatgag
ttattcggtcagttgcttagagaaacccaacgtataaaatcggaaggagattacaaggca
gtagagcatttggtagaaacctacggagtgaaagtagatcctgcacttcacaaggaagtt
ttggaaagaaacaaacaatttactgctgctccttatagtggttttgtcaatccggttctt
gttcctaaaatgaatgataaaggtgagattgagagtattggcgtggagcaaccaaaatcc
tttgaagaacaaatgttgttctactctaaaaactataacaatttgccagaggtaaattaa

DBGET integrated database retrieval system