KEGG   Aequorivita sp. H23M31: EI546_08145Help
Entry
EI546_08145       CDS       T05794                                 

Definition
(GenBank) aromatic amino acid hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
aev  Aequorivita sp. H23M31
Pathway
aev00360  Phenylalanine metabolism
aev00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aev00790  Folate biosynthesis
aev01100  Metabolic pathways
aev01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aev00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    EI546_08145
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EI546_08145
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EI546_08145
Enzymes [BR:aev01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     EI546_08145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H MIX
Motif
Other DBs
NCBI-ProteinID: QAA81697
UniProt: A0A410G341
Position
complement(1865359..1867134)
Genome map
AA seq 591 aa AA seqDB search
MEIRIESNELIDRLPPHLKQYIKPQDYEQYTPINQAVWRYVMRKNVDYLGKVAHESYVKG
LQKTGISIDEIPSMYGMNRILKEIGWAAVAVDGFIPPNAFMEFQAYKILVIASDIRQLEN
IEYTPAPDIIHEGAGHAPIIASPDYAEYLRRFGEIGAKAISSAHDIEMYEAVRELSILKE
AESISTEIINAAEHRLEELQNKKVNPSEISLIRNLHWWTVEYGLVGTVENPKIYGAGLLS
SIGESVWCMKEEVKKIPYSIDAAYQEFDITKPQPQLYVTPDFAYLQEVLEEFANTMAVRK
GGWRGLEKLIKSRQLGTIEISTGLQISGHFSRMIQNEDNEVIYFETKGKTALSYREKEVI
GHGINRHINGFRSPLGKLKGINLSIENMGPRDLQAYNFYDGKPISFEFESGITVEGLNVT
GMRNLRGELMLIQFTDCTVKYKDELLFTPEMGDFDMAVGKEIVSAFAGAADFNSFDLVTH
ISNSKTIRPNLSAEENELNSLYKEVRVIRHESEQDSTKLQNIYEILKQKYPNDWLLSLEI
YELVAKEDSSFSLEVLTHLSNLKEQRPKVAHLIEGGLMLLNNSEIRWEKQI
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaggattgagagtaacgagttgatagaccgcctaccgccccatttaaaacaa
tatatcaagcctcaggattatgagcagtacacgcccataaaccaagcagtatggcgatat
gtgatgcgaaaaaatgttgattatctcggcaaggtagcgcatgaaagttatgtgaagggg
cttcagaaaactggaatttccatcgatgaaattccgtcgatgtacgggatgaaccgaatt
ttaaaagaaattggttgggcagcagttgcagtcgacggatttattcctccaaatgctttt
atggaattccaggcctataaaatattggtcattgccagcgatatccgtcagcttgaaaat
attgaatacactcccgcccccgatattatccacgaaggggcgggtcatgcacccattatt
gcgagtccggattatgcggaatatttgaggagatttggtgaaattggggcaaaagcaatt
tccagtgctcacgatattgagatgtacgaggcagtccgtgagctttctattttaaaagag
gcggaaagtatctcaacggagataatcaatgctgcagaacaccgtttggaagaacttcaa
aacaagaaagtaaatccttctgaaatttccctgattcggaatttgcattggtggacagtt
gaatatggcttggtgggcacggtggaaaatccaaaaatttatggtgcgggcttgctatct
tccattggggaaagtgtttggtgtatgaaagaagaagtgaagaaaatcccttattctatt
gatgccgcctatcaagagtttgatattaccaagccacaaccccaactctatgttactcct
gattttgcgtatttgcaagaagtcctggaagagtttgcaaataccatggcggtgcgaaaa
ggcggatggcgaggattggaaaaactcataaaatcccgacaattaggtactattgaaatt
agtacgggcttacaaattagcggacactttagccgaatgatacaaaatgaggataacgaa
gtaatttactttgagaccaaaggaaaaaccgctctcagttatcgggaaaaggaagtaatc
gggcacgggattaatagacatattaacggttttcgttctcccttgggcaaattgaagggc
ataaatctatctattgaaaatatgggtccgcgcgatctacaggcttataatttttatgat
ggaaaacctatttcatttgagtttgaaagcggaattaccgtagaaggtttaaacgttacc
ggaatgagaaaccttagaggtgagttaatgcttatccagtttacggattgcacggtaaaa
tataaagatgaattgttgtttactccagaaatgggagattttgatatggcggtagggaag
gagattgtttcagcatttgcgggtgctgccgattttaattcatttgatctggtaacgcat
atttctaatagcaaaaccattcgtcctaatctttcggcggaggaaaatgaattaaactct
ctttataaagaagtgagagtgattcgtcatgaatctgaacaggattcgaccaagcttcaa
aatatatatgaaattctaaagcaaaaatatccaaacgactggcttctttctttggagatt
tatgagttggttgctaaagaggattctagtttttcactggaagtattgacacatctttca
aatttgaaagagcaacgtcctaaagtagctcatttgatagagggcggtttaatgctccta
aacaattcggaaattagatgggaaaaacaaatatga

DBGET integrated database retrieval system