KEGG   Aequorivita sp. H23M31: EI546_09960Help
Entry
EI546_09960       CDS       T05794                                 

Definition
(GenBank) glucose 1-dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
aev  Aequorivita sp. H23M31
Pathway
aev00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:aev00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    EI546_09960
Enzymes [BR:aev01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     EI546_09960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase GDP_Man_Dehyd 2-Hacid_dh_C Sacchrp_dh_NADP 3HCDH_N AdoHcyase_NAD NmrA Polysacc_synt_2 3Beta_HSD
Motif
Other DBs
NCBI-ProteinID: QAA82027
UniProt: A0A410G428
Position
complement(2277094..2277873)
Genome map
AA seq 259 aa AA seqDB search
MDISKHFDLKGKTAIVTGGAGGIGKACCEILAAYGAKVVVSDYNMEAAEKTSKEINDNGG
TSIAIDCNVLDDKALVNLVDKTVEKFGSIEILVNNVGGGGAGKESPYDIEVEQFKKVFEM
NVFSMWRLCQLVAPHMKKAGYGSIINMSSMASINKSPAISAYASSKAAINHMTRNLAFDY
GPDNIRVNAIGPGATRTHALSTVLTPDLEKAMLKHTPIHRLGEAEDIAGAVLYFAAPISS
WTSGQVIFINGGGEQTLDM
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggatatctcaaaacattttgatttaaaaggaaaaaccgcaatagtaacgggcggagct
ggaggaattggaaaagcttgctgcgaaatcttagcggcttatggagccaaagtggttgtc
tcagattacaatatggaggcagctgaaaaaacctcaaaagaaataaacgacaatggcgga
acatcaattgcgatagattgtaacgttcttgatgataaagctcttgtcaacttggtagat
aagaccgtcgagaaatttggaagcatcgaaatcttggtaaacaacgtcggcggcggtggc
gcaggaaaagaaagcccgtatgatattgaagtcgagcaatttaaaaaagttttcgaaatg
aacgtgttcagtatgtggcgactgtgccaattggtggcgccgcatatgaagaaagctggc
tatggaagtattatcaatatgtcttcaatggcatctatcaataaaagtccggcgattagt
gcgtatgcttcttccaaagctgcgatcaaccatatgacccgcaatcttgcatttgactat
ggacctgataatatccgtgtcaatgccataggtcctggcgctacaagaacccacgccttg
agtacggttttaacaccagatctggaaaaagctatgcttaaacacacgcctatccacaga
ttgggtgaagccgaggacattgctggggcagtattatattttgctgcacctatttcaagc
tggacgagtgggcaggttattttcattaatggcggtggagaacagacattggatatgtaa

DBGET integrated database retrieval system