KEGG   Aequorivita sp. H23M31: EI546_13800Help
Entry
EI546_13800       CDS       T05794                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
aev  Aequorivita sp. H23M31
Pathway
aev00900  Terpenoid backbone biosynthesis
aev01110  Biosynthesis of secondary metabolites
aev01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aev00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EI546_13800
Enzymes [BR:aev01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     EI546_13800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red RuvC_1 YqbF NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: QAA82727
UniProt: A0A410G622
Position
complement(3151643..3152956)
Genome map
AA seq 437 aa AA seqDB search
MNRAVSGFSKKSKTEKIAWLAANYLQENPHFIQILKNYWNEDTELQQLHDDFIENTLSNY
YLPFGIAPNFLINGEIYAIPMVTEESSVVAAASNAAKFWMDRGGFHAQVISTVKNGQIHF
NFFGSEKDIEEFFNDVKPKLRQSIQSLEKNMQGRGGGLLDLSFVDKSHILEGYFYIHATF
ETLDAMGANFINSCLEKMAQTFEEEARNYEAFQKVNELPEVVMSILSNYVPECVVRAEAS
CPVEDLTTKHHNGKQFAQKFIRAIEIAKTETRRAVTHNKGIMNGVDAVVLATGNDFRAVE
AGVHAYAARNSYYGSLTHAKIEDGIFTFWIELPLAIGTVGGLTSLHPLTKLAFEILQKPD
AKQLMQIIAVAGLAQNFAALRSLVTTGIQKGHMKMHLMNILNQFEASKEEKEQALEYFKV
NQVSHNAVVAFLAKLRG
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgagctgtttctggattttccaaaaaatctaagactgaaaaaattgcatggctt
gcagccaactacctgcaggaaaatccacattttatccagattctgaagaattactggaat
gaagatactgaattacagcagcttcacgatgattttattgaaaacacactttccaattat
tatcttccttttggtatagcacctaattttttgataaacggcgaaatctatgcaatccca
atggttacagaggaaagttctgtagtcgccgcggcaagcaatgcggctaaattttggatg
gatcgcggtggatttcatgctcaagtaatctctacggtaaaaaatggacagatccacttt
aatttttttggaagtgaaaaagatattgaggaattctttaatgacgtaaagccgaaactt
cgccaaagcattcagtccctagaaaagaacatgcagggccggggcgggggacttttagac
ctttcttttgtcgacaaatcacatattctggaaggttacttctacatccatgccacattt
gagaccttggatgcaatgggggcaaattttatcaatagttgcttggagaaaatggcgcag
acttttgaagaggaagcccgaaattatgaagcttttcaaaaagtaaatgagttgcccgaa
gtggtaatgagcattttatcgaactacgttcctgaatgtgtagtgcgcgccgaagctagt
tgccccgttgaagatcttactacaaaacatcataatgggaaacagtttgcacaaaagttt
atccgggcaatagaaattgcaaaaacagaaacccgtcgtgccgtaactcacaataaaggg
ataatgaatggtgtagatgcagtagtgctcgccaccggaaacgattttcgtgcggtggag
gcgggagtacacgcttatgctgcaagaaacagttactacggaagtctgacacacgcaaaa
atagaagacggtatttttactttctggatagaattgccgttggccattggcaccgttggt
ggattaacatcccttcatccattgacaaaacttgcctttgaaattttgcaaaaaccggat
gcaaaacaattgatgcaaataatagccgtcgccggccttgcccaaaactttgccgctcta
cgttccctggtaaccaccggaatccaaaaagggcatatgaaaatgcatttaatgaatatc
ctaaatcaatttgaggcttctaaagaagagaaagaacaggcgttggaatattttaaagta
aaccaggtttcgcataatgctgtggttgcgtttttggcgaaattgaggggatga

DBGET integrated database retrieval system