KEGG   Asticcacaulis excentricus: Astex_0238Help
Entry
Astex_0238        CDS       T01378                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00020  Citrate cycle (TCA cycle)
aex00310  Lysine degradation
aex01100  Metabolic pathways
aex01110  Biosynthesis of secondary metabolites
aex01120  Microbial metabolism in diverse environments
aex01130  Biosynthesis of antibiotics
aex01200  Carbon metabolism
Module
aex_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aex_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Astex_0238
  Amino acid metabolism
   00310 Lysine degradation
    Astex_0238
Enzymes [BR:aex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Astex_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_D23 GCV_H QRPTase_N HlyD_3
Motif
Other DBs
NCBI-ProteinID: ADU11938
UniProt: E8RP92
Position
1:256439..257977
Genome map
AA seq 512 aa AA seqDB search
MADILTPVLGESVSEATIAKWTKKPGDAVKKDEILVELETDKVSLEVAAPADGTLTEILA
GEGDTVTPGAVLGRIGAAGAAVASAPAAAPAATPAPAATPAAAPAAAGGALLDVKTPVMG
ESVAEGAISRWAKKVGEVVKKDEILVEIETDKVAVEVASPADGVIAEIVAADGATVTPGQ
VIARIAAGASAGSVAAAPAAAPAPVAAPASAPQKASEHLSPAVQRIVSETGLSTAGIAGT
GKDGRITKGDALAALSTPSAVAVAPVAAAPSAPVAPREVGPREERVKMTRLRQTIARRLK
ESQNTAAQLTTFNEVDMSTVMSLRNAYKDVFEKRHGVKLGFMSFFAKAVVAALKDIPALN
AEIEGTDIIYKNHYDLGVAVGTEKGLVVPVLRNVDDLSLAGIEKGIAALGKQARDGTLSL
DQLQGGTFTITNGGIYGSLMSTPILNMPQVGILGMHAIKERPMVVNGQIVARPMMYLALS
YDHRIVDGKEAVTFLVRVKEGLEDPQRFVLDV
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatccttacccccgtcctcggcgagtccgtttccgaggccaccattgccaag
tggaccaagaagcccggcgacgccgtgaagaaggacgaaatcctcgtcgagttggaaacc
gataaggtctcgctcgaagtggccgcccccgctgacggcaccctgaccgaaatactcgcc
ggtgaaggcgataccgtcacccccggtgccgtgctgggccgtatcggcgctgccggtgct
gcggtcgcttccgccccggcggctgcgcctgccgcgaccccggcgcccgcagctactccg
gctgccgctccggctgcggcgggtggtgccctgctcgacgtcaagaccccggtgatgggc
gagtcggtggccgaaggcgccatctcgcgctgggccaaaaaggtcggcgaagtggtgaag
aaggacgaaattctcgtcgaaatcgaaaccgataaggttgctgtcgaagtggcctcgccg
gccgatggcgtgatcgccgaaatcgtcgccgcagacggcgcgactgtcacgccgggtcag
gtcattgcccgtatcgccgccggcgcttcggcgggttcggtggccgctgcccccgccgcc
gctccggctccggtggctgctcccgcttcggccccgcaaaaggcctctgagcacctgtcg
cctgccgttcagcgtatcgtttccgaaaccggcctgagcactgccggtatcgccggcacc
ggcaaagacggccgcatcaccaagggcgacgccctcgccgccttgtccacgccctcggcg
gtcgctgtcgccccggtggccgctgcgccttcggctccggtcgccccgcgcgaagtcggc
ccgcgtgaagagcgcgtgaagatgacccgcctgcgtcagaccattgcccgccgcctgaag
gagtcgcaaaacaccgcggctcagctcaccaccttcaacgaagtggacatgtccaccgtg
atgagcctgcgcaacgcctataaggacgtctttgaaaagcgtcacggtgtgaagctgggc
tttatgtccttcttcgccaaggccgtcgtcgccgccctgaaggacattccggcgctcaac
gccgaaatcgaaggcacggacatcatctataagaaccactacgacctcggcgtcgccgtg
ggcacggaaaagggtctggtcgtgccggtcttgcgtaatgtcgatgacctgtcgctggcg
ggtatcgaaaagggcatcgccgcgctgggcaagcaggcacgtgacggcaccctgtcgctg
gatcagcttcaaggcggcaccttcaccatcaccaatggcggcatctatggctcgctgatg
tctacgcctatcctcaacatgccgcaggtcggtattcttggaatgcacgccatcaaggaa
cgcccgatggtcgtcaacggtcagatcgtcgcccgtccgatgatgtacctggccctgtct
tacgatcaccgcatcgtggacggcaaggaagccgtgaccttcctcgtccgcgtcaaggaa
ggtttggaagacccgcaacgtttcgtcctcgatgtgtaa

DBGET integrated database retrieval system