KEGG   Asticcacaulis excentricus: Astex_0457Help
Entry
Astex_0457        CDS       T01378                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00630  Glyoxylate and dicarboxylate metabolism
aex01100  Metabolic pathways
aex01110  Biosynthesis of secondary metabolites
aex01120  Microbial metabolism in diverse environments
aex01200  Carbon metabolism
Module
aex_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Astex_0457
Enzymes [BR:aex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Astex_0457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADU12152
UniProt: E8RQG8
Position
1:478976..480265
Genome map
AA seq 429 aa AA seqDB search
MTTFEHLVPNAPKGRFNGITRPYTPQEVEKLRGSVWVRNTLAERGANRLWQLLHEEPFIN
ALGAVTGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAAPELCRRINRT
LQRADQIEHSEGGAKRDWFAPIVADAEAGFGGPLNSFEIMKAFIEAGAAGVHFEDQLASE
KKCGHLGGKVLIPTQAHERNLIAARLAADVLGVPTLTVARTDAESAQLITSDIDERDHPF
IDRDSRTPEGFFRLKPGTGLDHCIARGLAYAKYADLLWWETSHPDLDDARRFAEAVHKVH
PGKLLAYNCSPSFNWKAKLDEATIARFQRELGAMGYKFQFVTLAGFHSLNNGMFELASGY
RDRGMAAYSELQQREFANEAAGYTATRHQREVGTGYFDKIAMTITNGQSSTTALKDSTET
AQFQTEPAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccactttcgagcacctggtgcccaacgccccgaagggacgcttcaacggcattacc
cgtccttacacgccgcaggaggtcgaaaagctgcggggttcggtgtgggtccgcaacacg
ctggccgagcgcggggccaaccgcctgtggcagctgctgcacgaggagccctttatcaat
gcgctgggtgccgtcaccggcaatcaggccatgcagatggtgcgcgccgggctcaaggcc
atctacctctctggctggcaggtcgcggcggacgccaacaccgcttcggccatgtatccg
gaccagtcgctttacccggccaatgccgcaccggaactgtgccgccgcatcaaccgcacg
cttcagcgcgccgatcagatcgagcattctgaaggcggcgcgaaacgcgactggttcgcc
cccatcgtcgccgacgctgaggccggcttcggcgggcccctcaacagttttgagattatg
aaggcctttatcgaggccggggcggcaggcgtgcattttgaggatcaactggcttctgaa
aagaagtgcggccacctcggcggtaaggtgctgatcccgacccaggcgcatgagcgcaat
ctgattgcggcccggctggcggccgacgtgctgggggtgccgacgcttaccgtggcgcgc
accgatgccgagtcggcgcagctcattacgtctgatattgacgagcgcgaccatccattc
atcgaccgcgacagccgcacgccggaaggcttcttccgtctgaagcccggaacggggctc
gatcattgcatcgctcgcggtctagcctatgccaaatacgccgacctgctgtggtgggaa
acctcgcacccggaccttgacgatgcgcgccgctttgccgaggccgtgcacaaggttcat
ccgggcaagctcttggcctataactgctcgccgtccttcaattggaaggcgaagctggac
gaggcgacgatcgccagattccagcgcgagttaggggctatgggctacaagttccagttc
gtaacgctggccggcttccactcgctgaataacggcatgttcgaactggcctccgggtac
cgcgaccgcggcatggcggcctattccgagcttcagcagcgtgaattcgccaatgaggcg
gcgggctataccgctacccgtcaccagcgcgaggtcggtaccggttatttcgacaagatc
gccatgaccatcacgaatggtcagtcctcgacgaccgccttgaaggactcgaccgaaacc
gctcaatttcaaacagagcccgcagagtaa

DBGET integrated database retrieval system