KEGG   Asticcacaulis excentricus: Astex_0750Help
Entry
Astex_0750        CDS       T01378                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00010  Glycolysis / Gluconeogenesis
aex00620  Pyruvate metabolism
aex00640  Propanoate metabolism
aex00680  Methane metabolism
aex01100  Metabolic pathways
aex01110  Biosynthesis of secondary metabolites
aex01120  Microbial metabolism in diverse environments
aex01130  Biosynthesis of antibiotics
aex01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Astex_0750
   00620 Pyruvate metabolism
    Astex_0750
   00640 Propanoate metabolism
    Astex_0750
  Energy metabolism
   00680 Methane metabolism
    Astex_0750
Enzymes [BR:aex01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Astex_0750
Lipid biosynthesis proteins [BR:aex01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Astex_0750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADU12435
UniProt: E8RKF5
Position
1:800637..802583
Genome map
AA seq 648 aa AA seqDB search
MTVDTLNNPTLFPVPATYPRAHSVTAAALQAQRDLVKSDPWAHWRQLGEALDWIKPFTQV
KDVSFNREDFRIRWYHDGQLNVAANCIDRHLPHKADTVAFIFEGDEPNDSYTVTYGQLAE
AVGKRANLLKKYGVKKGDRVTIYMPMVPEAAYFMLACARIGAVHSVVFGGFSPDSLAGRI
NDCQSEYVVTTIEGRRGGKSVPLKANTDLALLQCPGVKRVFVTGNGCSLSHDGRDLCVDP
ELEGLSADCPPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYLAWAAYTFKTVFDWHEGD
VYWCTADVGWVTGHSYVVYGPLANGATSLIFEGVPNYPTVSRFWEVIDKHQVTTFYTAPT
AIRALMREGDAPVLKTSRKSLRLLGSVGEPINPEAWLWYHRVVGNESCPIVDTWWQTETG
GHLITPVPGATALKPGSATHPLPGIEACLVDNEGKELSGATEGNLCICDSWPGQMRSVFG
DHQRFIETYFSTYPGKYFTGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEVESALVAH
HSVAEAAVVGFPHDIKGQGIYCYVTLTKGVEPTEALKTELRNWVRREIGPIASPDIIQWA
PGLPKTRSGKIMRRILRKIAERDVSNLGDISTLADPSVVADLVKGAGL
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgatacgctgaacaatccgactctctttcccgtgccggcgacctatccgcgc
gctcacagcgtgacggcggccgcgcttcaggcgcagcgtgatctggttaagtccgacccg
tgggcccactggcgtcaactgggcgaagcgctcgactggatcaagcccttcacgcaggtc
aaggatgtgtccttcaatcgcgaagacttccgcatccgctggtatcacgacggtcaactc
aacgtcgcggccaactgcatcgaccgccacctgccgcacaaggccgatacggtggccttt
atcttcgaaggcgatgagccgaacgattcttacacagtcacctatggccaactggccgaa
gcggtgggcaagcgcgcgaacctgcttaaaaagtatggcgtcaaaaaaggcgaccgcgtc
actatctatatgcccatggtaccagaagcggcctatttcatgctggcctgcgcgcgtatc
ggggcggtgcattcggtggtgttcggaggcttctcgcccgacagcctggccgggcgtatc
aatgactgtcagtcggaatacgtggtcacgaccatcgaaggccgtcgcggtggtaagtcg
gtgccgctcaaagccaataccgacctcgccctgctgcaatgccccggtgtgaagcgcgtc
ttcgtcaccggcaatggctgttcgctgagccatgacgggcgcgatctgtgcgtcgatccg
gaactggaaggtttaagcgccgactgcccgccagagccgatgaacgccgaagatcctctt
ttcatcctctacacgtccggttccacgggcaagcccaagggcgtgctgcacacgacgggc
ggctacctcgcttgggccgcctatacgtttaaaaccgttttcgactggcacgaaggcgat
gtctattggtgcaccgccgatgtgggctgggtgacgggccattcctacgtagtctatggt
ccgttggcgaatggggccacctcgttgatctttgaaggcgtacccaactaccccaccgtg
tcgcgcttctgggaggtgatcgacaagcatcaggtgacgaccttctacaccgcgccaacg
gccatccgcgcgctgatgcgcgaaggcgacgcaccggtgcttaagacctcgcgcaagtcg
ctgcgcctgctgggctctgtgggtgagccgatcaatcccgaagcctggctgtggtatcac
cgcgtggttggcaacgaaagctgccccattgtcgatacctggtggcagactgaaaccggc
gggcacctgattaccccggtgccgggcgccacggcgctcaagcccggttcggccacccac
cccctgccggggattgaggcttgtctggtcgataatgagggcaaggaacttagcggggcg
accgaaggcaatctgtgtatctgcgactcttggccgggtcagatgcgctcggtctttggc
gatcatcagcgttttatcgaaacctacttctcgacttatcctggcaagtacttcactggc
gatggcgcgcgccgcgatgaagacggctattactggatcaccggccgggttgatgacgtc
ctgaacgtctccggccaccgtctgggaacggctgaggtcgaaagcgcgctggtggcgcac
cacagcgttgccgaagccgccgtggtcggcttcccccacgacatcaaggggcagggcatc
tattgctacgtcaccctgacaaagggcgtcgaaccgaccgaagcgctgaagaccgaactg
cgcaactgggtgcgtcgcgaaatcggccccatcgcctcaccggacatcattcagtgggca
ccgggcctgcctaagacgcgctcaggcaagatcatgcgccgtatcctgcgcaagatcgcc
gaacgcgacgtttcaaaccttggtgatatttcgacgttggccgatccatcggtggtggcc
gatctggtcaagggcgctgggctttaa

DBGET integrated database retrieval system