KEGG   Asticcacaulis excentricus: Astex_0800Help
Entry
Astex_0800        CDS       T01378                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00260  Glycine, serine and threonine metabolism
aex01100  Metabolic pathways
aex01110  Biosynthesis of secondary metabolites
aex01120  Microbial metabolism in diverse environments
aex01130  Biosynthesis of antibiotics
aex01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aex00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Astex_0800
Enzymes [BR:aex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Astex_0800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ADU12484
UniProt: E8RKS4
Position
1:complement(845010..846047)
Genome map
AA seq 345 aa AA seqDB search
MVWFASDNTAPMHPAVLAALSAANKGHAASYGADEITARLTARLREVFGNPHLMAFPTFN
GSATNGVALASIMRPFEATIATRDAHIQNDECGLPEFFTGAKILIAPDVLGKLTPEGIEA
IVALSQDHAPHAARPKVISLTQSTEIGTVYGVEELRALRAVADRHGLLIHMDGARLANGV
AALGVSPAEAVTGVDILSFGGTKAGAALAEAVVILNPALIRDFEYWHKRMGQLPSKMRFV
SAQLLALIEDDLWLTLARHANGLAQRLAEGLSGLEGVALVYPQAANALFVTLPPALAEAL
QAAGHRFYPWSLAGEHVYRLVCSFATTEDEVTAFLTDCKMHLLSR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtctggttcgccagcgacaataccgcccccatgcaccccgccgttctggccgcgctg
agcgccgccaataaaggtcatgcggcctcctacggcgcggatgaaatcaccgcgcgcctc
actgcccgcctgcgcgaagtgtttggcaatccgcacctgatggccttcccgaccttcaac
ggatcggctaccaatggcgtggcgctggcctcgataatgcggccgttcgaagcgaccatt
gccacgcgcgacgcccatatccagaacgacgagtgcggcctgccagaattcttcaccggg
gccaaaatcctgattgcgccggacgtgctgggcaagctgacgcccgaaggcatcgaggcc
atcgtcgccctgtcgcaagaccatgccccgcatgctgcgcgcccgaaggtgatcagcctg
acgcaatcaaccgagatcggcacggtctatggtgtcgaggagttgcgcgcgctgcgggcc
gtggccgaccggcacggcctgctcattcacatggacggggcgcggctggccaacggagtg
gcggccttaggtgtatcgcctgccgaggccgtgaccggggtggatattctgtcgtttggc
ggcaccaaggccggcgcggccctggccgaagccgtggtaattttaaatccggccctaatc
cgcgattttgaatactggcacaagcgaatggggcagttgccgtccaagatgcgctttgtt
tcagcgcagctgctggctctgatcgaagacgatctatggctgacactggcgcggcacgcc
aatggcttggcgcagcgtctggccgaaggactgagcgggcttgagggggtagcgctggtc
tatcctcaggccgccaatgccctttttgtcaccctgcccccggctctggcggaggcgttg
caggccgccgggcaccgcttctatccgtggtctctggccggggagcacgtctatcggctg
gtgtgcagcttcgccacgaccgaagacgaagtcaccgcgtttttgacggattgcaagatg
cacctcctcagccgctga

DBGET integrated database retrieval system