KEGG   Asticcacaulis excentricus: Astex_0817Help
Entry
Astex_0817        CDS       T01378                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00340  Histidine metabolism
aex01100  Metabolic pathways
aex01110  Biosynthesis of secondary metabolites
aex01230  Biosynthesis of amino acids
Module
aex_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Astex_0817
Enzymes [BR:aex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Astex_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Glyoxalase_4
Motif
Other DBs
NCBI-ProteinID: ADU12501
UniProt: E8RKU1
Position
1:complement(861764..863062)
Genome map
AA seq 432 aa AA seqDB search
MKTFIWKDLSAAERKSALSRPENRRDARVLETVKTIFDDVEARGFAAVSDWAARLDGHAP
VRVELTRALVDEARANLAAEDLDAMELAVEHVRAFHTAELPSAGPIIAPSQGLSLQRLYR
PISTAGLYVPGGTAPLFSTLIMTAVPALVAGVPNRVCVTPPARDGSLHPMMIAAGAAAGL
EAVWRVGGAHAIAAMALGALPDVPAADKLFGPGNKYVAEAKRYATERVSGIAIDMPAGPS
ELMVIADASANAKLIAADLLSQAEHDADAQVVLVTLDAALIAAVGVELETQLATLPRAAI
ARASLEQARLFVVDSLEAAAEVANHYGPEHLALQVADLDAMIPQLTAAGTVFAGTYAAET
FGDYAAGPSHVLPTDGAARAWDGITIRSFLTSFVVQRATKHGAANIAPAAARLARLEGLE
AHALAADFRLEV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaagacctttatctggaaagacctcagcgcggcggaacgtaaatccgccctctcgcgt
ccggaaaaccggcgcgacgctcgcgtgcttgaaacggtgaaaaccatattcgacgacgtt
gaagctcgaggctttgccgccgtcagcgactgggcggcgcgcctcgacggtcacgctccc
gtgcgcgtcgaactgacgcgtgctctggtcgatgaggcgcgcgccaatctggctgccgaa
gatctcgacgccatggaactggcggttgaacacgtgcgcgccttccacacggctgagctg
ccgtccgccggaccgatcattgcaccatcgcaaggtctgtcgcttcagcgcctttatcgc
cccatctcgaccgccggcctctatgtcccaggtggcacggcgccgctgttttcgaccctg
atcatgaccgccgtgcccgctctggtcgccggcgtgcccaaccgtgtttgcgtcacaccg
ccggccagagacggctcgctgcaccccatgatgatcgctgccggggccgccgccggtctt
gaggccgtgtggcgtgtcggcggggcacacgccatcgccgctatggctctgggcgcgttg
ccagacgtcccggcggcggacaagctgtttgggccgggcaacaagtacgtcgctgaagcc
aaacgctacgccaccgagcgcgtctccggcatcgcgattgacatgcccgccggtccgtcg
gagctgatggttattgccgacgcttcggcaaacgcgaagctgatcgctgccgacctgctg
tcgcaggccgaacacgacgccgacgcgcaggtggtgctggtgacgctggacgccgcccta
atcgcggccgttggtgttgagcttgagacgcaactggcgaccctgcctcgcgccgccatt
gcccgcgcctcgctggagcaggcgcgcctgttcgtcgtcgatagccttgaggctgcagcc
gaggttgccaaccactacggccccgagcacctggcgcttcaggtggccgatctagacgcc
atgatcccgcaactcaccgccgccggaacggtattcgccgggacctatgccgcggagacc
ttcggcgactatgcggccggccccagccatgtcctgccgaccgacggcgcggcacgcgcc
tgggacggcatcaccatacgctccttcctgaccagctttgtggtccaacgcgccaccaaa
cacggcgcagcgaatattgcgcccgcggcggcgcgtctggcgcgtctggaaggccttgag
gcccacgcgctggcggcagatttccggttagaggtttaa

DBGET integrated database retrieval system