KEGG   Asticcacaulis excentricus: Astex_0822Help
Entry
Astex_0822        CDS       T01378                                 

Definition
(GenBank) phospholipase C, phosphocholine-specific
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00562  Inositol phosphate metabolism
aex00564  Glycerophospholipid metabolism
aex01100  Metabolic pathways
aex01110  Biosynthesis of secondary metabolites
aex02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:aex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Astex_0822
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Astex_0822
   00565 Ether lipid metabolism
    Astex_0822
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Astex_0822
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:aex02042]
    Astex_0822
Enzymes [BR:aex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     Astex_0822
Bacterial toxins [BR:aex02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   Astex_0822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal
Motif
Other DBs
NCBI-ProteinID: ADU12506
UniProt: E8RKU6
Position
1:complement(867577..869658)
Genome map
AA seq 693 aa AA seqDB search
MTSRRTFLRATLSSTLAASLGSLPPTIARALDIPAHTRTGTIKDVEHVVILMQENRSFDH
YFGTMNGVQGFGDRFVIPAPATPAHQNRTVFAQQREDDPTRLIAPFALNTTQDFRLIRLE
GTPHSFKDAQAAWDEGRLSQWPKSKHNHAMAHFERADLPFQYALAEAFTLCDAYFCAMHS
GTNPNRVVHWTGTNVGPNGPVIANDYDELHADPKGHGGYDWTTYPERLSAAGIDWRLYQN
MKDNFTDNPLVGFKTYRAADKATSGKLADLAERSIRTRDLDKLKEDVLAGKLPQVSWIIG
TAEGSEHPSTSSPAQGADYTAKVLEALTANPKVWAKTVLLINFDENDGYFDHVPPPAPPS
LDANGQPLGYAEGAEREYHQGDDALKNRPYGLGPRVPMYVISPWSKGGYVASEVFDHTSV
IRFLETRFGVHEPNISPWRRAVCGDLTSCFDFKTPNDQPFFAHLPKTADRAEQARRLSGK
TTPKTPDALTAPVQEQGLRPRRATPYRFETGVEVSTIHVKVIFFVDPDAKAAVFHVYDRL
KPEAAPYRYTVKDNEGKAEYTLTGTGGQSFDLFILGPNGFHQRLTGAFADLPAVFGLGVL
PKGAYYGLDETGRASFDYRLTDNAYGGVAQDLHLHSDPINAAHTFGIDTTKTHGWFDISV
QFGGVTIRCAGHVEDGKPSLSDPAAFGAARLTI
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgaccagccgccgcacctttcttcgcgccaccctcagcagcactctggcggcgtcttta
ggcagcctgcccccgaccattgcgcgcgccctggacatccccgcccacactcgtaccggc
acgatcaaagacgttgaacacgtcgtcatcctgatgcaggaaaaccgcagtttcgaccac
tatttcggcacgatgaacggcgtgcagggctttggcgaccgctttgtcatcccggccccg
gcgacgcctgcccaccaaaaccgaaccgtctttgcccagcagcgtgaggacgaccccacc
cggctgatcgcgccatttgcgctcaacaccacccaggatttccgcctgatacgcctcgaa
ggcacgccgcacagcttcaaggacgcgcaggccgcctgggacgaagggcgcctgagccag
tggcccaaatctaagcacaatcacgccatggcgcattttgaacgcgccgatctaccgttt
cagtacgctctcgccgaagccttcaccctgtgcgacgcctatttctgcgccatgcattcg
ggcaccaatcccaaccgcgtggtccactggacgggcaccaatgtcggccccaatggcccg
gtcatcgccaatgattatgacgaactgcacgccgatcctaagggccacggcggctatgac
tggaccacctatccggagcgtctgagtgcggcgggcatcgactggcgcctctatcagaac
atgaaggacaacttcaccgacaacccgctggttggctttaagacctatcgcgccgccgat
aaggccacgtcgggcaaactcgcagacctcgccgaacgctcgatccgcacgcgcgacctc
gataagctgaaagaagacgtactggccggcaagctgccgcaggtgtcgtggatcatcggt
acggccgaaggctccgaacacccctcgacctcttcgccggcgcaaggggccgactatacg
gctaaggtgctcgaagccctgaccgccaatccgaaggtgtgggccaagaccgtccttttg
atcaatttcgatgagaatgacggctatttcgaccatgtgccgccgcccgccccgccgtcg
ctggacgccaatggacagccgctgggctatgcagaaggggcggagcgcgaatatcatcag
ggtgacgacgcgctgaaaaaccgcccctatggcctgggcccgcgcgtgccgatgtacgtc
atttcgccgtggtcaaagggcggctatgtggcctctgaggtgttcgaccacacctcggtc
atccgttttctggaaacgcgctttggcgtgcacgagcccaatatctcaccgtggcggcgc
gccgtgtgtggcgacctgacctcgtgctttgatttcaagacaccgaacgatcagcccttc
tttgcgcacctgcccaaaaccgccgaccgcgccgaacaggcgcgacgcttaagcggcaag
acgacgcccaaaacgcccgacgccctcaccgctccggtgcaggaacagggcctgcgcccc
cgccgcgcgacgccttatcgctttgagacaggggtggaagtcagcaccattcacgttaag
gtcatcttctttgtcgatccggacgcgaaggctgcggtttttcacgtctatgaccgcttg
aagccagaggcggcgccctatcgctacaccgtcaaagacaatgaagggaaggctgagtac
acgcttaccggaaccggcggtcaatcctttgacctgtttatcctcggtcccaacggattt
caccagcgcctgaccggtgcgtttgccgacctgccagcggtctttggtctgggggttctg
ccgaagggagcctattacggtctggatgagacgggacgcgcctccttcgattaccgcctc
acagacaatgcctatggcggtgttgcacaggatctgcatctgcacagcgacccgatcaat
gccgctcacaccttcggcattgacacgacaaagacgcatggctggttcgacatcagcgtg
caatttggcggcgtgacgatccgctgcgctggtcatgtcgaagacggcaagccgtcgctg
tccgacccggcggcgtttggggccgcgaggctgacgatctga

DBGET integrated database retrieval system