KEGG   Asticcacaulis excentricus: Astex_0841Help
Entry
Astex_0841        CDS       T01378                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00071  Fatty acid degradation
aex00072  Synthesis and degradation of ketone bodies
aex00280  Valine, leucine and isoleucine degradation
aex00310  Lysine degradation
aex00362  Benzoate degradation
aex00380  Tryptophan metabolism
aex00620  Pyruvate metabolism
aex00630  Glyoxylate and dicarboxylate metabolism
aex00640  Propanoate metabolism
aex00650  Butanoate metabolism
aex00900  Terpenoid backbone biosynthesis
aex01100  Metabolic pathways
aex01110  Biosynthesis of secondary metabolites
aex01120  Microbial metabolism in diverse environments
aex01130  Biosynthesis of antibiotics
aex01200  Carbon metabolism
aex01212  Fatty acid metabolism
aex02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Astex_0841
   00630 Glyoxylate and dicarboxylate metabolism
    Astex_0841
   00640 Propanoate metabolism
    Astex_0841
   00650 Butanoate metabolism
    Astex_0841
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Astex_0841
   00072 Synthesis and degradation of ketone bodies
    Astex_0841
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Astex_0841
   00310 Lysine degradation
    Astex_0841
   00380 Tryptophan metabolism
    Astex_0841
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Astex_0841
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Astex_0841
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Astex_0841
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aex04147]
    Astex_0841
Enzymes [BR:aex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Astex_0841
Exosome [BR:aex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Astex_0841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADU12524
UniProt: E8RKW4
Position
1:889417..890625
Genome map
AA seq 402 aa AA seqDB search
MSVSSVSDVVIVAAARTPVGSFLGGLASLSGADLGAHVIKAVLERSGLKADEIDEVILGQ
VLTAAQGQGPARQAAIKGGLPNTTPAWGINQICGSGLRAVALAAQQIALGDAKVVIAGGQ
ESMSQANHAAFLRNGQKFGDISFADTMIKDGLWDAFNNYHMGQTAENIAAKWEITRVAQD
EFAVASQNKAEAAQKAGKFDAEIAPVIIKGRKGDTVVDKDEFIRHGATLDSVAGLKPAFL
KDGTVTAANASGLNDGAAALILMSADEAAARGLKPLARIKSWATAGVDPAIMGTGPIPAS
KKALEKAGWSVADLDLVESNEAFAAQALCVVKELGLDTSKVNVNGGAIAIGHPIGASGAR
ILTTLIFELNRRASEAGKPLKGLATLCIGGGMGVALTVETLG
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtaagctctgtgtctgacgtggtgatcgtggctgcggcccgtacaccggtcggt
tcgtttctgggtggtttggcctctttgtcgggggcggatctgggcgcccatgtaatcaag
gccgttctggaacgctccggcctcaaggcagacgagatcgacgaagtgatcctgggtcag
gtgctgaccgccgcgcagggccagggaccggcccgtcaggcagcgatcaagggcggcctg
cccaacaccaccccggcctggggcatcaaccaaatctgcggctcaggcctgcgcgcggtg
gcgctagctgcgcagcagatcgcgctgggagatgccaaggtggtcatcgccggcggtcag
gaaagcatgtcgcaggccaatcacgcagccttcctgcgcaatggtcagaaattcggggac
atttcgtttgccgataccatgatcaaggacggcctgtgggacgccttcaacaactatcat
atggggcagacggccgaaaacatcgcggccaagtgggagatcacccgagtagcgcaggac
gaattcgccgtcgcctcgcaaaataaggccgaagccgctcagaaggctggcaagttcgac
gcggaaattgccccggtgatcattaaggggcgcaagggcgatacggtcgtcgataaggac
gaattcatccgccatggcgcaacgctcgacagtgtggcaggcctcaagcccgcttttctg
aaggacggcacggtaacggcggcgaatgcgtcgggtctcaatgatggtgcggcggcgttg
atcctgatgtctgccgacgaagcagcggcgcgcggcctgaagcctctggcgcgcatcaaa
tcgtgggcgacggcgggcgtcgatccggccatcatgggcacggggccaatcccggcttcg
aaaaaggcgctggaaaaggcgggttggagcgtcgccgatctcgacctcgtcgaatcgaac
gaagcttttgccgctcaggctctgtgcgtggtcaaggaattggggcttgacacttcgaag
gtcaatgtcaacggcggcgccatcgccataggccatccgatcggggcgtcgggcgcgcgc
attctgaccaccttgatcttcgaactgaaccgccgcgccagcgaagcgggcaagcccctg
aagggtctggccacgctttgcatcggtggggggatgggcgtcgccctgactgtcgagacc
cttgggtaa

DBGET integrated database retrieval system